GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisE in Synechococcus elongatus PCC 7942

Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate Synpcc7942_1519 Synpcc7942_1519 histidinol dehydrogenase

Query= SwissProt::P00815
         (799 letters)



>lcl|FitnessBrowser__SynE:Synpcc7942_1519 Synpcc7942_1519 histidinol
           dehydrogenase
          Length = 434

 Score =  278 bits (710), Expect = 6e-79
 Identities = 162/407 (39%), Positives = 242/407 (59%), Gaps = 11/407 (2%)

Query: 388 VNPIIENVRDKGNSALLEYTEKFDGVKLSNPVLNAPFPE--EYFEGLTEEMKEALDLSIE 445
           V  I++ V+ +G++AL+E+T++FDG  L    L     E    ++ + +E+ +A+ L+  
Sbjct: 34  VREIVQAVQRRGDAALIEFTQEFDGFALQAENLRVSGAELDAAYQQIPKELLDAIRLAHH 93

Query: 446 NVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKVGLYIPGGTAILPSTALMLGVPAQVA 505
            +  FH  ++P   ++      VL  R+  P+++ GLY+PGG A  PST LM  VPA+VA
Sbjct: 94  QIEAFHRQRVPKSWVQFGADGEVLGKRYT-PVDRAGLYVPGGRAAYPSTVLMNAVPAKVA 152

Query: 506 QCKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLAGGAQAVAAMAYGTETIPKVDKIL 565
             + +V  +PP   DG ++P V+  A++ G  +I   GGAQA+AA+AYGT TIPKVD I 
Sbjct: 153 GVERVVITTPPGP-DGSLNPAVLVAAQEAGIEEIYRVGGAQAIAALAYGTATIPKVDVIS 211

Query: 566 GPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEDADVDFVASDLLSQAEHGIDS 625
           GPGN +VT AK  V         ID  AGPSEVL+IAD  A+  +VA+DLL+QAEH   +
Sbjct: 212 GPGNIYVTLAKKLVYGTV----GIDSLAGPSEVLIIADRSANPRWVAADLLAQAEHDPLA 267

Query: 626 QVILVGVNLSEKKIQEIQDAVHNQALQLPRVDIVRKCIAHSTI-VLCDGYEEALEMSNQY 684
             IL+  +L  +   ++   V  Q    PR  +  K IAH  + ++ D  E A+++SNQ+
Sbjct: 268 AAILITPDL--ELATQVGFEVERQLQDHPRRLVTEKAIAHYGLAIVVDSLETAVKLSNQF 325

Query: 685 APEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDYSSGTNHTLPTYGYARQYSGANT 744
           APEHL L++ +    V+ V +AG++F+G+ TPE+ GDY +G NHTLPT G AR  S  + 
Sbjct: 326 APEHLELEVEDPWALVEQVRHAGAIFLGSLTPEAIGDYVAGPNHTLPTSGAARYASALSV 385

Query: 745 ATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNAVKIRMSKL 791
            TF K  +    T   L+ + RAV  +A  EGL+ H  +V++R   L
Sbjct: 386 ETFLKSSSLIEYTAASLQRVARAVDVLATAEGLESHAESVRLRQQSL 432


Lambda     K      H
   0.315    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 653
Number of extensions: 28
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 799
Length of database: 434
Length adjustment: 37
Effective length of query: 762
Effective length of database: 397
Effective search space:   302514
Effective search space used:   302514
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory