Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate Synpcc7942_2160 Synpcc7942_2160 alanine-glyoxylate aminotransferase
Query= BRENDA::P74281 (384 letters) >FitnessBrowser__SynE:Synpcc7942_2160 Length = 384 Score = 178 bits (452), Expect = 2e-49 Identities = 112/351 (31%), Positives = 186/351 (52%), Gaps = 11/351 (3%) Query: 4 KQMLMIPGPTPVPEKVLLAMAKHPIGHRSGDFSKIIAELTANLKWLHQTENDVLMLTTSG 63 +++L+ PGP+ VL A+++ PIGH F +++ E+ L+++ QT+N L + SG Sbjct: 23 ERLLLGPGPSNAHPAVLEAISRPPIGHLDPKFLELMTEVQGLLRYIWQTDNR-LTIPVSG 81 Query: 64 TG--AMEASIINFLSPGDRVLVGNNGKFGDRWVKVAKTFGLAVEEIKAEWGKALDPNDFK 121 TG AMEA+I N + PGD VLVG G FG+R V +A +G V I WG + + Sbjct: 82 TGSAAMEATIANSVEPGDVVLVGVMGYFGNRLVDMAGRYGADVRTIHKPWGDVFSLAELR 141 Query: 122 TLLEADSDKTIKALIITHSETSTGVLNDLAAINAAAKAHGGALMIVDAVTSLGATPVAID 181 LE + + L + H+ETSTG LA + + L+++D VTSLGA P +D Sbjct: 142 QALE---EHRPQILALVHAETSTGAEQPLAGVGDLCREF-DCLLLIDTVTSLGAVPTLLD 197 Query: 182 DLGLDVVASGSQKGYMIPPGLGFVSVSAKAWQ--AYETATIPRFYLDLKKYKKSTDEDS- 238 + G+D+ S SQKG PPG+ ++ +A + A + +YLD+ + D Sbjct: 198 EWGVDLAYSCSQKGLSCPPGVSPFTMGPRAEEKLARRKGKVANWYLDMSLLNQYWGSDRV 257 Query: 239 SPFTPPINLMYGLQASLQMMKAEGLDAIFTRHQRHTNATRGAMKALNLPLFAP-DNAASN 297 T P+N+ +G++ +L+++ EG++ ++ RH+ + ++ L L P +N Sbjct: 258 YHHTAPVNMNFGIREALRLIADEGIETVWKRHRDNAEYLWAGLEDLGLTCHVPVENRLPT 317 Query: 298 AITAVAPLGVEAEKIRSTMRKKFDIAMAGGQDHLKGKIFRIGHLGFVCDRD 348 T P GV+ + + + + I M GG L GK++RIG +G+ R+ Sbjct: 318 LTTVRIPEGVDGKAVSRQLLDEHGIEMGGGLGELAGKVWRIGLMGYNSRRE 368 Lambda K H 0.317 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 15 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 384 Length adjustment: 30 Effective length of query: 354 Effective length of database: 354 Effective search space: 125316 Effective search space used: 125316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory