Align N-acetyldiaminopimelate deacetylase; EC 3.5.1.47 (characterized)
to candidate Synpcc7942_1971 Synpcc7942_1971 Peptidase M20D, amidohydrolase
Query= SwissProt::O34916 (374 letters) >FitnessBrowser__SynE:Synpcc7942_1971 Length = 252 Score = 165 bits (417), Expect = 1e-45 Identities = 97/231 (41%), Positives = 135/231 (58%), Gaps = 6/231 (2%) Query: 6 LIAIRRDLHRIPELGFQEFKTQQYLLNVLEQYPQDRIEIEKWRTGLFVKVNGTAPEKM-L 64 L+ IRR LH PEL E +T Y+ VL ++ RTG+ + GT ++ L Sbjct: 21 LLEIRRHLHAHPELSGHEHQTAAYVAGVLSSCGL-QVREGVGRTGVVGDLPGTGRDRRCL 79 Query: 65 AYRADIDALSIEEQTGLPFASEHHGNMHACGHDLHMTIALG--IIDHFVHHPVKHDLLFL 122 A R D+DAL IEEQTGLPFAS G MHACGHDLH T+ LG ++ + P+ D+ +L Sbjct: 80 ALRTDMDALPIEEQTGLPFASRQQGIMHACGHDLHTTLGLGAAMVLSELGEPLPGDVRWL 139 Query: 123 FQPAEEGPGGAEPMLESDVLKKWQPDFITALHIAPELPVGTIATKSGLLFANTSELVIDL 182 FQPAEE GA M+ ++ L+ D I +H+ P +P G + + G L A +L I + Sbjct: 140 FQPAEEIAQGARWMVAAEALEG--VDAILGVHVFPSIPAGVVGIRYGALTAAADDLEIVI 197 Query: 183 EGKGGHAAYPHLAEDMVVAASTLVTQLQTIISRNTDPLDSAVITVGTITGG 233 +G+ GH A PH A+D + A+ ++T LQ ISR +PL V+T+G I GG Sbjct: 198 QGESGHGARPHEAKDAIWIAAQIITMLQQAISRTQNPLRPVVLTIGQIQGG 248 Lambda K H 0.319 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 252 Length adjustment: 27 Effective length of query: 347 Effective length of database: 225 Effective search space: 78075 Effective search space used: 78075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory