GapMind for Amino acid biosynthesis

 

Aligments for a candidate for serB in Synechococcus elongatus PCC 7942

Align 2-oxoglutarate reductase; EC 1.1.1.399; EC 1.1.1.95; EC 3.1.3.3 (characterized, see rationale)
to candidate Synpcc7942_1501 Synpcc7942_1501 D-3-phosphoglycerate dehydrogenase

Query= uniprot:L0G228_ECHVK
         (630 letters)



>lcl|FitnessBrowser__SynE:Synpcc7942_1501 Synpcc7942_1501
           D-3-phosphoglycerate dehydrogenase
          Length = 546

 Score =  175 bits (444), Expect = 4e-48
 Identities = 105/344 (30%), Positives = 184/344 (53%), Gaps = 7/344 (2%)

Query: 235 VLLLENVHPIGVEIMKQEGYNVEVVSSAMSEEELCEKIKNVSIIGIRSKTQITKKVLENA 294
           VL+ + +  +G++I+ Q    V+V  + +S  EL + I     + +RS T++T +V+E  
Sbjct: 21  VLVSDPIDQVGLDILSQVA-QVDV-KTGLSPSELAQIIGEYDALMLRSGTRVTAEVIEAG 78

Query: 295 NRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLMRNLHDKTLK 354
            +L  +G   +G + +D+     +GI V N+P  NT +  E  ++ ++ L R++ D    
Sbjct: 79  QKLRIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIPDANAS 138

Query: 355 MHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYD--IVERLALGNA 412
              G W++ +    EV  K LG++G G IG+ ++ +A+ MGM +  YD  I    A    
Sbjct: 139 TKSGGWDRKSFVGTEVYKKTLGVVGLGKIGSHVATVAKAMGMKLLAYDPFISAERAEQIG 198

Query: 413 TKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHVVDVPALRD 472
            ++  LD L +  D I+LH+    E  N++N E + KMK    ++N +RG V++  AL D
Sbjct: 199 ARLVELDILFQEADYITLHIPKTPETANLINAETLAKMKPTTRIINCARGGVINEQALAD 258

Query: 473 ALESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQENIAQFVPGK 532
           A+ +G + GAA+DV+  EP   D P  +  +G  N ILTPH+G ST EAQ N+A  V  +
Sbjct: 259 AIAAGKIGGAALDVYDQEPLQADSPLRA--LG-KNLILTPHLGASTTEAQVNVAVDVAEQ 315

Query: 533 IIEYINSGNTFNSVNFPNIQLPFLKDAHRLIHIHQNAPGVLAKI 576
           I + +      ++VN P +    L+     + + +    +L+++
Sbjct: 316 IRDVLLGLPARSAVNIPGLYPDILEKLRPYLQLAETLGNLLSQV 359



 Score = 28.5 bits (62), Expect = 8e-04
 Identities = 13/61 (21%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 566 HQNAPGVLAKINQVLASYKINI----VGQYLKTNEKIGYVITDIDKRYSNDVIDALKEIE 621
           H++ PG++ KI  +L S+ +NI    VG+ +   + +  ++  +D      ++  + ++ 
Sbjct: 479 HRDMPGIIGKIGSLLGSFNVNIASMQVGRRIVRGDAV--MVLSLDDPLPEGILAEITKVA 536

Query: 622 G 622
           G
Sbjct: 537 G 537


Lambda     K      H
   0.317    0.136    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 626
Number of extensions: 33
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 630
Length of database: 546
Length adjustment: 37
Effective length of query: 593
Effective length of database: 509
Effective search space:   301837
Effective search space used:   301837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory