Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate Synpcc7942_2612 Synpcc7942_2612 threonine synthase
Query= BRENDA::O66740 (352 letters) >FitnessBrowser__SynE:Synpcc7942_2612 Length = 366 Score = 428 bits (1101), Expect = e-124 Identities = 211/351 (60%), Positives = 271/351 (77%), Gaps = 4/351 (1%) Query: 4 WQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEADNLARAIGFKGKIYLKYEGLNPTGSFK 63 W G+I+ Y+ YLPV + TPIVTL+EGNTPLI +AR IG ++++KY+GLNPTGSFK Sbjct: 18 WPGLIEAYRDYLPVTDTTPIVTLHEGNTPLIPVPTIAREIGRGVEVFVKYDGLNPTGSFK 77 Query: 64 DRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLRAYVLLPKGAVAIGKLSQAM 123 DRGMT+AI+KA EAG +AVICASTGNTSA+AAAYA R GLRA+VL+P G VA GKL+QA+ Sbjct: 78 DRGMTMAITKAKEAGAKAVICASTGNTSAAAAAYARRGGLRAFVLIPDGFVAQGKLAQAL 137 Query: 124 IYGAKVLAIQGTFDDALNIVRKIGENFPVEIVNSVNPYRIEGQKTAAFEICDTLGEAPDY 183 +YGA+VLAI+G FD AL IVR++ +PV +VNS+NPYR+EGQKTAAFE+ D LGEAPD+ Sbjct: 138 LYGAEVLAIKGNFDRALEIVREVANQYPVTLVNSLNPYRLEGQKTAAFELIDVLGEAPDW 197 Query: 184 HFIPVGNAGNITAYWKGFKIYYEEGKITKLPRMMGWQAEGAAPIVKGYPIKNPQTIATAI 243 IP+GNAGNI+AYW GF+ Y+ +G KLPRMMG+QA G+AP+V G +++P TIATAI Sbjct: 198 LCIPMGNAGNISAYWMGFQEYHAKGLSQKLPRMMGFQAAGSAPLVTGEIVQSPDTIATAI 257 Query: 244 KIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIASTEGVFCEPASAASVAGLIKLV 303 +IGNP +W+ AL+ +ES G +AV+D+EIL AY+++A EG+FCEPASAASVAG++K Sbjct: 258 RIGNPANWQRALRVHEESNGAFNAVTDAEILDAYRMLAGQEGIFCEPASAASVAGMLKCK 317 Query: 304 REGFFKGGEVVTCTLTGNGLKDPDTAIKVCEEPIT--VPPDFDEVVKVLGF 352 E G + C LTGNGLKDP +AI+ + PD D V +GF Sbjct: 318 DE--IPDGATIVCVLTGNGLKDPSSAIEFSHTGFKAGIEPDLDIVAHTMGF 366 Lambda K H 0.317 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 366 Length adjustment: 29 Effective length of query: 323 Effective length of database: 337 Effective search space: 108851 Effective search space used: 108851 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate Synpcc7942_2612 Synpcc7942_2612 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.32031.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-104 336.0 0.0 1.5e-104 335.8 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_2612 Synpcc7942_2612 threonine syntha Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_2612 Synpcc7942_2612 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 335.8 0.0 1.5e-104 1.5e-104 1 339 [. 22 338 .. 22 339 .. 0.96 Alignments for each domain: == domain 1 score: 335.8 bits; conditional E-value: 1.5e-104 TIGR00260 1 vvryreilevt.ekdlvdlaegstelfrspklaeevga.enlyvkelfhgPtlaFKDrglqfvavlltk 67 ++ yr +l+vt +++v+l+eg+t+l+ +p++a+e+g +++vk ++++Pt++FKDrg +++++tk lcl|FitnessBrowser__SynE:Synpcc7942_2612 22 IEAYRDYLPVTdTTPIVTLHEGNTPLIPVPTIAREIGRgVEVFVKYDGLNPTGSFKDRG---MTMAITK 87 6789*******99*************************9********************...******* PP TIGR00260 68 alelgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDda 136 a+e+g+++v+cA++G+t+aaaa a+a++ +++++vL+P+g ++ ++kl++al ++a+vlaikG+FD a lcl|FitnessBrowser__SynE:Synpcc7942_2612 88 AKEAGAKAVICASTGNTSAAAA-AYARRGGLRAFVLIPDGFVA--QGKLAQALLYGAEVLAIKGNFDRA 153 **********************.********************..************************ PP TIGR00260 137 qdlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGflek 204 +++v+e++++ + +++ns N p+r+e+qkt+afe+++ lg e+pd++++p++ +gn++a+++Gf+e+ lcl|FitnessBrowser__SynE:Synpcc7942_2612 154 LEIVREVANQYPVTLVNSLN---PYRLEGQKTAAFELIDVLG-EAPDWLCIPMGnAGNISAYWMGFQEY 218 ********776666666666...*******************.************************** PP TIGR00260 205 kelg....lpieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnveralelarrslgnl 269 + +g lp ++++++a g+a+ v+ ++++T++tA++ignp+n++ral++ ++s+g + lcl|FitnessBrowser__SynE:Synpcc7942_2612 219 HAKGlsqkLP-RMMGFQAAGSAPLVTGE-------IVQSPDTIATAIRIGNPANWQRALRVHEESNGAF 279 **********.**********9999987.......56789***************************** PP TIGR00260 270 edlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevvealtgnklkd 338 +++ +d+eil+a++ la +eg+++ep++a++va+++k + +++ + +++v++ltgn+lkd lcl|FitnessBrowser__SynE:Synpcc7942_2612 280 NAV----TDAEILDAYRMLAGQEGIFCEPASAASVAGMLKCKD-----EIPDG--ATIVCVLTGNGLKD 337 ***....*********************************987.....78999..*************9 PP TIGR00260 339 p 339 p lcl|FitnessBrowser__SynE:Synpcc7942_2612 338 P 338 8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (366 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.69 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory