Align Tryptophan synthase beta chain 1; EC 4.2.1.20 (characterized, see rationale)
to candidate Synpcc7942_2143 Synpcc7942_2143 tryptophan synthase subunit beta
Query= uniprot:P50383 (425 letters) >FitnessBrowser__SynE:Synpcc7942_2143 Length = 420 Score = 129 bits (324), Expect = 2e-34 Identities = 116/364 (31%), Positives = 162/364 (44%), Gaps = 51/364 (14%) Query: 72 IGRPTPLFRAKRLEEYLKTP----ARIYFKYEGATPTGSHKINTAIPQAYFAKEEGIEHV 127 +GRP PL+ A+RL EY + P IY K E TG+HKIN A+ QA AK G + + Sbjct: 75 VGRPNPLYFAERLTEYYRRPDGQGPNIYLKREDLNHTGAHKINNALGQALMAKRMGKKRI 134 Query: 128 VTETGAGQWGTAVALAASMYNMKSTIFMVKVSYEQKPMRRSIMQLYGANVYASPTNLTEY 187 + ETGAGQ G A A + + ++ I+M E++ + M+L GA V Sbjct: 135 IAETGAGQHGVATATVCARFGLECVIYMGVHDMERQALNVFRMRLMGAEVRGVAAG---- 190 Query: 188 GRKILETNPQHPGSLGIAMSEAIEYALKN--EFRYLVGSVLD------VVLLHQSVIGQE 239 G+L A SEAI + N Y++GSV +V S+IG+E Sbjct: 191 -----------SGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVREFHSMIGRE 239 Query: 240 TITQLDLL-GEDADILIGCVGGGSNFGGFTYPFIGNKKGKRYIAVSSAEIPKFSKGEYKY 298 Q L G DIL+ CVGGGSN G F+ N+ R I V +A +G Sbjct: 240 VRQQAQTLWGGLPDILLACVGGGSNAMGLFNEFV-NEPSVRLIGVEAA-----GRG---V 290 Query: 299 DFPDSAGLLPLVKMITL-----------GKDYVPPPIYAGGLRYHGVAPTLSLLTKEGIV 347 D P+ A L ++ L + + GL Y GV P S L G Sbjct: 291 DTPEHAATLTKGRVGVLHGAMSYLLQDDDGQVIEAHSISAGLDYPGVGPEHSYLMDAGRA 350 Query: 348 EWREYNEREIFEAAKIFIENQGIVPAPESAHAIRAVVDEAIEARKNNERKVIVFNLSGHG 407 E+ + E EA + +GI+PA E+AHA A +++ N +V N SG G Sbjct: 351 EYYSVTDDEALEAFQRISRLEGIIPALETAHAF-AHLEKLCPTLSGNPN--LVINCSGRG 407 Query: 408 LLDL 411 D+ Sbjct: 408 DKDV 411 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 420 Length adjustment: 32 Effective length of query: 393 Effective length of database: 388 Effective search space: 152484 Effective search space used: 152484 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Synpcc7942_2143 Synpcc7942_2143 (tryptophan synthase subunit beta)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.11196.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-192 624.5 0.0 4.1e-192 624.3 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_2143 Synpcc7942_2143 tryptophan synth Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_2143 Synpcc7942_2143 tryptophan synthase subunit beta # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 624.3 0.0 4.1e-192 4.1e-192 1 384 [. 29 417 .. 29 418 .. 0.98 Alignments for each domain: == domain 1 score: 624.3 bits; conditional E-value: 4.1e-192 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskkl.....g 64 g+fg+fGGqyvpe+l++al+ele+a+ ++++d+ef++e+e ll++y+grp pl+fa++l++ + + lcl|FitnessBrowser__SynE:Synpcc7942_2143 29 GRFGRFGGQYVPETLMPALAELEQAFARYSRDPEFQAEFEGLLRDYVGRPNPLYFAERLTEYYrrpdgQ 97 78**********************************************************976333224 PP TIGR00263 65 gakiylkredllhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaed 133 g +iylkredl+htGahkinnalgqal+akr+GkkriiaetGaGqhGvatat++a++glec++ymG +d lcl|FitnessBrowser__SynE:Synpcc7942_2143 98 GPNIYLKREDLNHTGAHKINNALGQALMAKRMGKKRIIAETGAGQHGVATATVCARFGLECVIYMGVHD 166 679****************************************************************** PP TIGR00263 134 verqklnvfrmellgakvvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsv 202 +erq+lnvfrm+l+ga+v v Gs tlkda++ea+rdWvt+ve+thy+lGs++GphP+P ivref s+ lcl|FitnessBrowser__SynE:Synpcc7942_2143 167 MERQALNVFRMRLMGAEVRGVAAGSGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVREFHSM 235 ********************************************************************* PP TIGR00263 203 igeevkeqilekegrlPdaviacvGGGsnaiGifaafiedeeveligveagGkGidtekhaatlskGke 271 ig+ev++q + g lPd+++acvGGGsna+G+f++f+++++v+ligvea+G+G+dt +haatl+kG++ lcl|FitnessBrowser__SynE:Synpcc7942_2143 236 IGREVRQQAQTLWGGLPDILLACVGGGSNAMGLFNEFVNEPSVRLIGVEAAGRGVDTPEHAATLTKGRV 304 ********************************************************************* PP TIGR00263 272 GvlhGaktkllqdedGqieeahsvsaGldypgvgPehaalaetgraeyeaitdeealealkllskeeGi 340 GvlhGa+++llqd+dGq+ eahs+saGldypgvgPeh++l++ graey ++td+ealea++++s+ eGi lcl|FitnessBrowser__SynE:Synpcc7942_2143 305 GVLHGAMSYLLQDDDGQVIEAHSISAGLDYPGVGPEHSYLMDAGRAEYYSVTDDEALEAFQRISRLEGI 373 ********************************************************************* PP TIGR00263 341 ipalesshalaaleklapklkkdeivvvnlsGrGdkdletvaka 384 ipale++ha a+lekl+p+l+ + +v+n sGrGdkd++tva++ lcl|FitnessBrowser__SynE:Synpcc7942_2143 374 IPALETAHAFAHLEKLCPTLSGNPNLVINCSGRGDKDVQTVAQR 417 *****************************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (420 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.10 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory