Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate Synpcc7942_1794 Synpcc7942_1794 succinyldiaminopimelate transaminase
Query= BRENDA::Q8YUK5 (404 letters) >FitnessBrowser__SynE:Synpcc7942_1794 Length = 392 Score = 521 bits (1341), Expect = e-152 Identities = 259/403 (64%), Positives = 308/403 (76%), Gaps = 17/403 (4%) Query: 2 QFSQRLHPLQSNVFADMDKAKSLALAAGKELIDLSLGSSDLPAEAHVIEAIAKSLYDPST 61 + SQRL PLQ NVFADMD+AK++A+AAG+E+IDLSLGSSDLPA HV+ IA SL DPST Sbjct: 5 RLSQRLAPLQRNVFADMDRAKAVAIAAGREVIDLSLGSSDLPAPDHVVAVIAASLQDPST 64 Query: 62 HGYLLFNGTRDFRQAAANWYEQKFGVKVDPETEVLPLIGSQEGTAHLPLALLNPGDFALL 121 HGYLL GT FRQ AA WYE+KFG+ VDPETEVL LIGSQEGTAHLPLA++ PG+ ALL Sbjct: 65 HGYLLHQGTLPFRQVAAAWYERKFGLGVDPETEVLLLIGSQEGTAHLPLAVMEPGEIALL 124 Query: 122 LDPGYPSHAGGVYLASGQIYPMPLKAENDFLPVFADIPTDVLAQSRMMVLSYPHNPTAAI 181 DPGYPSHAGGVYLA G+IY +P A+ FLP F+ IPT++L++SR++VLSYPHNPT AI Sbjct: 125 QDPGYPSHAGGVYLAGGEIYRLPTTADRGFLPDFSTIPTEILSRSRLLVLSYPHNPTTAI 184 Query: 182 APLSFFKEAVAFCQEHNIALVHDFPYVDMVFENAGNLNTNLPQSPIPNHQSLVPSILQAD 241 APL+FF+EAVAFC+ H + L HDFPY D+ F+ VPSI QAD Sbjct: 185 APLAFFEEAVAFCRHHQLVLAHDFPYPDLGFDGVE-----------------VPSIFQAD 227 Query: 242 PDKSVSIEFFTLSKSYNMGGFRIGYAIGNAQMIQALRQIKAAVDFNQYRGILNGAIAALT 301 K +IEFF+LSKSYNMGGFR+G+AIGNA++I ALR++KA VDFNQY+GIL GAIAALT Sbjct: 228 RQKQQAIEFFSLSKSYNMGGFRVGFAIGNAELIGALRRLKAVVDFNQYQGILAGAIAALT 287 Query: 302 GPQAGVEAAVSTFCQRRDAFINALHHIGWYVPTPKATMYIWAKLPSSWSQNSIEFCTQLV 361 GPQA VEA F RRD FINAL GW +P P +TMY+WA LP W S+EFC +LV Sbjct: 288 GPQACVEATRQRFRDRRDIFINALAATGWTIPKPVSTMYLWAPLPEPWQTRSLEFCEKLV 347 Query: 362 RQTGVAASPGAGFGKSGEGYVRFALVHEPSILKIAVERMSNFL 404 +TGVAASPG GFG GEG+VRFALVH+ L+ A R++ FL Sbjct: 348 AETGVAASPGIGFGDCGEGFVRFALVHDRDRLEEAARRITQFL 390 Lambda K H 0.320 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 546 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 392 Length adjustment: 31 Effective length of query: 373 Effective length of database: 361 Effective search space: 134653 Effective search space used: 134653 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory