Align Ornithine carbamoyltransferase 1, anabolic; OTCase 1; Ornithine carbamoyltransferase 1, phaseolotoxin-sensitive; SOCT; EC 2.1.3.3 (characterized)
to candidate GFF1103 PS417_05595 ornithine carbamoyltransferase
Query= SwissProt::Q02047 (306 letters) >FitnessBrowser__WCS417:GFF1103 Length = 306 Score = 534 bits (1375), Expect = e-156 Identities = 265/306 (86%), Positives = 285/306 (93%) Query: 1 MNARHFLSMMDYTPDELLGLIRRGVELKDLRIRGELFEPLKNRVLGMIFEKSSTRTRLSF 60 M+ARHFLS+MD TP+EL+ +IRRG+ELKDLR RG LFEPLKNRVLGMIFEKSSTRTR+SF Sbjct: 1 MSARHFLSLMDCTPEELVSVIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRVSF 60 Query: 61 EAGMIQLGGQAIFLSHRDTQLGRGEPIADSAKVMSRMLDAVMIRTYAHSNLTEFAANSRV 120 EAGMIQLGGQAIFLS RDTQLGRGEPIADSAKVMS MLDAVMIRT+AHS +TEF+ANSRV Sbjct: 61 EAGMIQLGGQAIFLSSRDTQLGRGEPIADSAKVMSSMLDAVMIRTFAHSTVTEFSANSRV 120 Query: 121 PVINGLSDDLHPCQLLADMQTFLEHRGSIKGKTVAWIGDGNNMCNSYIEAAIQFDFQLRV 180 PVINGLSDDLHPCQLLADMQTFLEHRGSI+GKTVAWIGDGNNMCNSYIEAAIQFDFQLRV Sbjct: 121 PVINGLSDDLHPCQLLADMQTFLEHRGSIQGKTVAWIGDGNNMCNSYIEAAIQFDFQLRV 180 Query: 181 ACPAGYEPNPEFLALAGERVTIVRDPKAAVAGAHLVSTDVWTSMGQEEETARRMALFAPF 240 ACP GYEP+ FLA AG+RVT+VRDP+ AV GAHLVSTDVWTSMGQE+ETA+R+ALFAP+ Sbjct: 181 ACPEGYEPDARFLAQAGDRVTLVRDPRDAVIGAHLVSTDVWTSMGQEDETAKRLALFAPY 240 Query: 241 QVTRASLDLAEKDVLFMHCLPAHRGEEISVDLLDDSRSVAWDQAENRLHAQKALLEFLVA 300 QVTRA LDLA DVLFMHCLPAHRGEEIS DLLDD RSVAWDQAENRLHAQKALLEFLV Sbjct: 241 QVTRALLDLAAPDVLFMHCLPAHRGEEISTDLLDDPRSVAWDQAENRLHAQKALLEFLVP 300 Query: 301 PSHQRA 306 PS+ A Sbjct: 301 PSYHHA 306 Lambda K H 0.322 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 306 Length of database: 306 Length adjustment: 27 Effective length of query: 279 Effective length of database: 279 Effective search space: 77841 Effective search space used: 77841 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate GFF1103 PS417_05595 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.4531.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-118 380.2 0.0 3.9e-118 380.0 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF1103 PS417_05595 ornithine carbamoylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF1103 PS417_05595 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 380.0 0.0 3.9e-118 3.9e-118 1 303 [. 4 299 .. 4 300 .. 0.99 Alignments for each domain: == domain 1 score: 380.0 bits; conditional E-value: 3.9e-118 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvlylnkee 75 rh+lsl+d ++eel++++ ++ +lk +++g+ + lk++ l++iFek+stRtRvsfe+++++lG+q+++l++ + lcl|FitnessBrowser__WCS417:GFF1103 4 RHFLSLMDCTPEELVSVIRRGIELKDLRNRGVLFEPLKNRVLGMIFEKSSTRTRVSFEAGMIQLGGQAIFLSSRD 78 8************************************************************************** PP TIGR00658 76 lqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltikeklgklkevk 150 +qlgr+e+i+D a+v+s+++da+++R+++h++v+e++ ++ vPvingL+d hPcq+laD++t e+ g++++ + lcl|FitnessBrowser__WCS417:GFF1103 79 TQLGRGEPIADSAKVMSSMLDAVMIRTFAHSTVTEFSANSRVPVINGLSDDLHPCQLLADMQTFLEHRGSIQGKT 153 *************************************************************************** PP TIGR00658 151 lvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkleltedpkkavkdadviytDvw 225 ++++GD+nn++ns + aa ++ ++++va+Peg+ep+a+ + +a g +++l++dp +av +a+++ tDvw lcl|FitnessBrowser__WCS417:GFF1103 154 VAWIGDGNNMCNSYIEAAIQFDFQLRVACPEGYEPDARFLAQA-------GDRVTLVRDPRDAVIGAHLVSTDVW 221 *************************************998877.......88*********************** PP TIGR00658 226 vsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdevlegeasivfdeaenRlhaqkavlk 300 +smG+e+++++rl+l+ pyqv++ ll+la p+v f+hCLPa+rGee++ + l+ ++s+ +d+aenRlhaqka+l+ lcl|FitnessBrowser__WCS417:GFF1103 222 TSMGQEDETAKRLALFAPYQVTRALLDLAAPDVLFMHCLPAHRGEEISTDLLDDPRSVAWDQAENRLHAQKALLE 296 **************************************************************************9 PP TIGR00658 301 all 303 +l+ lcl|FitnessBrowser__WCS417:GFF1103 297 FLV 299 975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (306 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.50 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory