Align 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 (characterized)
to candidate GFF1599 PS417_08135 3-phosphoshikimate 1-carboxyvinyltransferase
Query= SwissProt::Q83E11 (438 letters) >FitnessBrowser__WCS417:GFF1599 Length = 736 Score = 446 bits (1148), Expect = e-130 Identities = 237/424 (55%), Positives = 299/424 (70%), Gaps = 2/424 (0%) Query: 7 PSQGLSGEICVPGDKSISHRAVLLAAIAEGQTQVDGFLMGADNLAMVSALQQMGASIQVI 66 P LSG I VPGDKSISHR+++L ++AEG T+V+GFL G D LA + A + MG I+ Sbjct: 308 PGGRLSGRIRVPGDKSISHRSIMLGSLAEGVTEVEGFLEGEDALATLQAFRDMGVVIEGP 367 Query: 67 EDENILVVEGVGMTGLQAPPEALDCGNSGTAIRLLSGLLAGQPFNTVLTGDSSLQRRPMK 126 + + GVG+ GL+ P + GNSGT++RLLSGLLA Q F++VLTGD+SL +RPM Sbjct: 368 HHGRV-TIHGVGLHGLKPAPGPIYLGNSGTSMRLLSGLLAAQSFDSVLTGDASLSKRPMS 426 Query: 127 RIIDPLTLMGAKIDS-TGNVPPLKIYGNPRLTGIHYQLPMASAQVKSCLLLAGLYARGKT 185 R+ PL MGA I++ PPL I G L G+ Y +PMASAQVKSCLLLAGLYA GKT Sbjct: 427 RVAKPLREMGAVIETGPEGRPPLTIRGGQSLKGLAYAMPMASAQVKSCLLLAGLYAEGKT 486 Query: 186 CITEPAPSRDHTERLLKHFHYTLQKDKQSICVSGGGKLKANDISIPGDISSAAFFIVAAT 245 + EPAP+RDHTER+L+ F Y + + + V G L A I +PGDISS+AFF+VAA+ Sbjct: 487 VVAEPAPTRDHTERMLRGFGYPVAVEGATASVESGHALAATHIEVPGDISSSAFFLVAAS 546 Query: 246 ITPGSAIRLCRVGVNPTRLGVINLLKMMGADIEVTHYTEKNEEPTADITVRHARLKGIDI 305 I GS + L VGVNPTR GVI++L++MGADI + + E EP AD+ VR A LKGI+I Sbjct: 547 IAEGSELLLEHVGVNPTRTGVIDILRLMGADITLENQREVGGEPVADLRVRAAALKGIEI 606 Query: 306 PPDQVPLTIDEFPVLLIAAAVAQGKTVLRDAAELRVKETDRIAAMVDGLQKLGIAAESLP 365 P VPL IDEFPVL +AAA A+G+TVLR A ELRVKE+DRI M DGL LG+ E Sbjct: 607 PEALVPLAIDEFPVLFVAAACAEGRTVLRGAQELRVKESDRIQVMADGLLALGVKCEPTA 666 Query: 366 DGVIIQGGTLEGGEVNSYDDHRIAMAFAVAGTLAKGPVRIRNCDNVKTSFPNFVELANEV 425 DG+II GG + GGEV+++ DHRIAMAF+VA A P+RIR+C NV TSFPNF+ L +V Sbjct: 667 DGIIIDGGLIGGGEVHAHGDHRIAMAFSVASLRAATPIRIRDCANVATSFPNFLTLCAQV 726 Query: 426 GMNV 429 G+ V Sbjct: 727 GIRV 730 Lambda K H 0.318 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 903 Number of extensions: 43 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 736 Length adjustment: 36 Effective length of query: 402 Effective length of database: 700 Effective search space: 281400 Effective search space used: 281400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
Align candidate GFF1599 PS417_08135 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.18390.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-128 414.7 0.0 2.7e-128 414.2 0.0 1.2 1 lcl|FitnessBrowser__WCS417:GFF1599 PS417_08135 3-phosphoshikimate 1 Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF1599 PS417_08135 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 414.2 0.0 2.7e-128 2.7e-128 1 413 [. 314 727 .. 314 729 .. 0.96 Alignments for each domain: == domain 1 score: 414.2 bits; conditional E-value: 2.7e-128 TIGR01356 1 geikipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakve.eekeelviegvgg..lkepeae 72 g+i++pg+KSishR+++l++Laeg t+v+++L++eD latl+a+r++G+ +e ++++++i+gvg lk + lcl|FitnessBrowser__WCS417:GFF1599 314 GRIRVPGDKSISHRSIMLGSLAEGVTEVEGFLEGEDALATLQAFRDMGVVIEgPHHGRVTIHGVGLhgLKPAPGP 388 79**************************************************666*********9876666669* PP TIGR01356 73 ldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeegslPlaisgplkg.give 146 ++lgnsGt++Rll+g+la++s+++vltgd sl+kRP+ r+ ++Lre+ga ie eg++Pl+i+g++++ g + lcl|FitnessBrowser__WCS417:GFF1599 389 IYLGNSGTSMRLLSGLLAAQSFDSVLTGDASLSKRPMSRVAKPLREMGAVIETGP-EGRPPLTIRGGQSLkGLAY 462 ****************************************************876.69*********8888**** PP TIGR01356 147 lsgsaSsQyksalllaaplalqavtleivgeklisrpyieitLkllksfgveveeederkivvkggqkykqkeve 221 ++aS+Q+ks+llla+ l a++ ++v e+ +r+++e++L ++ v +e + +v+ g++ + +++e lcl|FitnessBrowser__WCS417:GFF1599 463 AMPMASAQVKSCLLLAG---LYAEGKTVVAEPAPTRDHTERMLRGFGYP---VAVEGA-TASVESGHALAATHIE 530 *****************...778899****************9998876...777665.889**999999999** PP TIGR01356 222 vegDaSsAafflaaaaitge.evtvenlgenstqgdkaiiivLeemGadveveeqr........dvevegasklk 287 v+gD+Ss affl+aa i+++ e+ +e++g n+t+++ +i++L+ mGad+++e+qr d++v+ a lk lcl|FitnessBrowser__WCS417:GFF1599 531 VPGDISSSAFFLVAASIAEGsELLLEHVGVNPTRTG--VIDILRLMGADITLENQRevggepvaDLRVR-AAALK 602 *******************99***************..788****************************.789** PP TIGR01356 288 gvkv.didvdsliDelptlavlaafAegetriknieelRvkEsdRiaaiaeeLeklGveveeledgllieGkkke 361 g+++ ++ v+ +iDe+p+l v+aa+Aeg t++++++elRvkEsdRi+++a+ L +lGv++e+++dg++i G+ lcl|FitnessBrowser__WCS417:GFF1599 603 GIEIpEALVPLAIDEFPVLFVAAACAEGRTVLRGAQELRVKESDRIQVMADGLLALGVKCEPTADGIIIDGG--L 675 ****99******************************************************************..6 PP TIGR01356 362 lkgavvdtydDHRiamalavlglaaegeveiedaecvaksfPeFfevleqlg 413 + g++v+ ++DHRiama++v++l+a+ +++i d + va+sfP+F+ + +q+g lcl|FitnessBrowser__WCS417:GFF1599 676 IGGGEVHAHGDHRIAMAFSVASLRAATPIRIRDCANVATSFPNFLTLCAQVG 727 99********************************************999987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (736 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 16.91 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory