Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate GFF2099 PS417_10705 phospho-2-dehydro-3-deoxyheptonate aldolase
Query= BRENDA::P00888 (356 letters) >FitnessBrowser__WCS417:GFF2099 Length = 359 Score = 355 bits (911), Expect = e-102 Identities = 182/347 (52%), Positives = 236/347 (68%), Gaps = 4/347 (1%) Query: 5 ALNNVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKSISDIIAGRDPRLLVVCGPCSI 64 AL + + Q L + +LK PLS Q+ R ++ I+ G D RLLV+ GPCSI Sbjct: 12 ALTSANEALTQRLPSSLELKHQLPLSPFLTEQVHAHRHAVRAILNGEDSRLLVIVGPCSI 71 Query: 65 HDPETALEYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDVEAGL 124 HDPE+A+EYAR K LA EVSD + LV+R Y EKPRTT+GWKGL DPH+DGS D+ AGL Sbjct: 72 HDPESAMEYARNLKKLALEVSDQMLLVIRAYVEKPRTTIGWKGLAYDPHLDGSDDMAAGL 131 Query: 125 QIARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGLSMPV 184 ++R+L+ E++ +GLP+ATE L P + Y DL SW AIGARTTESQ HREMASGL MPV Sbjct: 132 TLSRQLMREMLRLGLPVATELLQPMAAGYFDDLLSWVAIGARTTESQIHREMASGLGMPV 191 Query: 185 GFKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGG-KAPNYS 243 GFKNGTDG +A A +AMR+A+ PHR G++ G A++QT GNPD H++LRGG + PNY Sbjct: 192 GFKNGTDGGVAIACDAMRSASHPHRHFGVDSQGHPAIIQTPGNPDTHLVLRGGHRGPNYD 251 Query: 244 PADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGLMIE 303 VAQ + ++ ++ + +MVDCSH NS KD RQPAV V+ Q G+ S+IG+M+E Sbjct: 252 AQSVAQVKHDLAKSKVAARIMVDCSHANSGKDPLRQPAVFNEVLDQRLQGDTSLIGMMLE 311 Query: 304 SNIHEGNQSSEQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNGQ 350 S++ EG Q + MKYGVSVTD C+ W T+ LLR + L Q Sbjct: 312 SHLFEGCQPLS---ASMKYGVSVTDGCLGWNGTEQLLRSAAERLREQ 355 Lambda K H 0.316 0.131 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 359 Length adjustment: 29 Effective length of query: 327 Effective length of database: 330 Effective search space: 107910 Effective search space used: 107910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate GFF2099 PS417_10705 (phospho-2-dehydro-3-deoxyheptonate aldolase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.8246.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-138 445.2 0.0 7.6e-138 444.9 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF2099 PS417_10705 phospho-2-dehydro-3- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF2099 PS417_10705 phospho-2-dehydro-3-deoxyheptonate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 444.9 0.0 7.6e-138 7.6e-138 9 342 .] 22 356 .. 15 356 .. 0.98 Alignments for each domain: == domain 1 score: 444.9 bits; conditional E-value: 7.6e-138 TIGR00034 9 delltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkklaeklkddle 83 ++l + elk++ pl++ +e+v+ r+++ il+G+d+rllv++GPcsihdpe+a+eya+ lkkla +++d++ lcl|FitnessBrowser__WCS417:GFF2099 22 QRLPSSLELKHQLPLSPFLTEQVHAHRHAVRAILNGEDSRLLVIVGPCSIHDPESAMEYARNLKKLALEVSDQML 96 56778899******************************************************************* PP TIGR00034 84 ivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispqyladllswgaiG 158 +v+r+y+ekPrtt+GWkGl dP+l++s d+ +Gl ++r+l+ ++ lglp+atell+++++ y+ dllsw aiG lcl|FitnessBrowser__WCS417:GFF2099 97 LVIRAYVEKPRTTIGWKGLAYDPHLDGSDDMAAGLTLSRQLMREMLRLGLPVATELLQPMAAGYFDDLLSWVAIG 171 *************************************************************************** PP TIGR00034 159 arttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaivetkGnedghiilrGGkk 233 arttesq+hre+asgl +pvgfkngtdG++++a da+r+a+++h+ ++v+ +G+ ai++t Gn+d+h++lrGG++ lcl|FitnessBrowser__WCS417:GFF2099 172 ARTTESQIHREMASGLGMPVGFKNGTDGGVAIACDAMRSASHPHRHFGVDSQGHPAIIQTPGNPDTHLVLRGGHR 246 *************************************************************************** PP TIGR00034 234 .pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqsl 307 pnyda++va+vk++l k + +++m+d+sh+ns kd rq++v ++v +q +G++++iG+m+es+l eG q l lcl|FitnessBrowser__WCS417:GFF2099 247 gPNYDAQSVAQVKHDLAKSKVAARIMVDCSHANSGKDPLRQPAVFNEVLDQRLQGDTSLIGMMLESHLFEGCQPL 321 9************************************************************************** PP TIGR00034 308 keelkyGksvtdacigwedteallrklaeavkerr 342 ++++kyG+svtd c+gw+ te+llr ae ++e+r lcl|FitnessBrowser__WCS417:GFF2099 322 SASMKYGVSVTDGCLGWNGTEQLLRSAAERLREQR 356 ****************************9999875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.05 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory