GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisG in Pseudomonas simiae WCS417

Align ATP phosphoribosyltransferase; ATP-PRT; ATP-PRTase; EC 2.4.2.17 (uncharacterized)
to candidate GFF870 PS417_04415 ATP phosphoribosyltransferase catalytic subunit

Query= curated2:Q3J7H0
         (213 letters)



>lcl|FitnessBrowser__WCS417:GFF870 PS417_04415 ATP
           phosphoribosyltransferase catalytic subunit
          Length = 211

 Score =  274 bits (700), Expect = 1e-78
 Identities = 135/208 (64%), Positives = 168/208 (80%)

Query: 5   LKLALSKGRIFQEILPLLAIAGIYPRDDPKTSRKLVLDTNQADLKLVIIRAADVPTYVEY 64
           L +ALSKGRI  + LPLLA AGI P ++P  SRKL++ T Q D++L+I+RA DVPTYVE+
Sbjct: 2   LTIALSKGRILDDTLPLLAEAGIVPTENPDKSRKLIIPTTQDDVRLLIVRATDVPTYVEH 61

Query: 65  GAADFGVAGKDVLLEHPGNGLYEPLDLRIACCRMMVAGEPEVTPRSGRLRIATKYVHSTR 124
           GAAD GVAGKDVL+E+ G GLYEPLDLRIA C++M AG        GRLR+ATK+V+  +
Sbjct: 62  GAADLGVAGKDVLMEYGGQGLYEPLDLRIALCKLMTAGRVGDVEPKGRLRVATKFVNVAK 121

Query: 125 RFYAERGEQVEVIKLYGSMELAPLVGLADRIVDLVDTGNTLRANGLAPLEHITDISSRLV 184
           R+YAE+G QV++IKLYGSMELAPL+GLAD+I+D+VDTGNTLRANGL P E I DISSRL+
Sbjct: 122 RYYAEQGRQVDIIKLYGSMELAPLIGLADKIIDVVDTGNTLRANGLEPQEFIADISSRLI 181

Query: 185 VNKASMKMRHQRIKKFICLMAEAVEKQH 212
           VNKASMKM+H RI+  I  + +AVE +H
Sbjct: 182 VNKASMKMQHARIQALIDTLRKAVESRH 209


Lambda     K      H
   0.322    0.139    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 218
Number of extensions: 6
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 213
Length of database: 211
Length adjustment: 21
Effective length of query: 192
Effective length of database: 190
Effective search space:    36480
Effective search space used:    36480
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)

Align candidate GFF870 PS417_04415 (ATP phosphoribosyltransferase catalytic subunit)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00070.hmm
# target sequence database:        /tmp/gapView.26365.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00070  [M=183]
Accession:   TIGR00070
Description: hisG: ATP phosphoribosyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
    1.7e-57  180.4   0.0      2e-57  180.1   0.0    1.1  1  lcl|FitnessBrowser__WCS417:GFF870  PS417_04415 ATP phosphoribosyltr


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__WCS417:GFF870  PS417_04415 ATP phosphoribosyltransferase catalytic subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  180.1   0.0     2e-57     2e-57       1     183 []       2     182 ..       2     182 .. 0.94

  Alignments for each domain:
  == domain 1  score: 180.1 bits;  conditional E-value: 2e-57
                          TIGR00070   1 lriAlpKGrleeetlkllekaglklskke..erkliasaedeevevlllrakdiptyvekgaadlGitGkDlleEs 74 
                                        l+iAl KGr++++tl ll++ag+  +++   +rkli+ +++++v++l++ra+d+ptyve+gaadlG+ GkD+l+E 
  lcl|FitnessBrowser__WCS417:GFF870   2 LTIALSKGRILDDTLPLLAEAGIVPTENPdkSRKLIIPTTQDDVRLLIVRATDVPTYVEHGAADLGVAGKDVLMEY 77 
                                        79********************9987766699*******************************************6 PP

                          TIGR00070  75 ead.vvelldlgfgkcklvlAvpeesdvesledlkegk.riATkypnltreylekkgvkveivkleGavElapllg 148
                                        + + ++e ldl++  ckl+ A +    ve     k g+ r+ATk++n++++y++++g +v+i+kl+G++Elapl+g
  lcl|FitnessBrowser__WCS417:GFF870  78 GGQgLYEPLDLRIALCKLMTAGRVGD-VEP----K-GRlRVATKFVNVAKRYYAEQGRQVDIIKLYGSMELAPLIG 147
                                        5555*****************99887.444....3.556************************************* PP

                          TIGR00070 149 ladaIvDivetGttLrengLkiieeilessarlia 183
                                        lad I+D+v tG+tLr+ngL+  e i ++s+rli+
  lcl|FitnessBrowser__WCS417:GFF870 148 LADKIIDVVDTGNTLRANGLEPQEFIADISSRLIV 182
                                        *********************************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (183 nodes)
Target sequences:                          1  (211 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 7.26
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory