Align Histidinol-phosphatase; Hol-Pase; Histidinol-phosphate phosphatase; EC 3.1.3.15 (characterized)
to candidate GFF1835 PS417_09335 HAD family hydrolase
Query= SwissProt::Q9I6F6 (217 letters) >FitnessBrowser__WCS417:GFF1835 Length = 217 Score = 167 bits (422), Expect = 2e-46 Identities = 86/214 (40%), Positives = 131/214 (61%), Gaps = 2/214 (0%) Query: 1 MRLALFDLDNTLLAGDSDHSWGEWLCQRGLVDAAEYQARNDAFYADYVAGKLDVLAYQAF 60 M L +FDLD+TL+ GD W E + + G VD + +N+ Y GKL + + F Sbjct: 1 MALVIFDLDDTLIHGDCATLWSEQMGRLGWVDPESFMRKNNELMDAYSQGKLRMEEFMDF 60 Query: 61 T-QAILGRTEMAQLETWHRQFMQEVIEPIVLAKGEALLAEHRAAGDRLVIITATNRFVTG 119 + + ++GRT ++E ++++VIEP++ + +A HRA GDR+++I+A+ + Sbjct: 61 SLEPMIGRTP-EEIEHLVEPWVEDVIEPLIYSDATKTIARHRANGDRILVISASGTHLVT 119 Query: 120 PIAERLGVETLIATECEMRDGRYTGQTFDVPCFQGGKVVRLQRWLDENGLDLEGASFYSD 179 PIA R+G++ ++ ++ G Y+G+T DV ++ GK+ RL WL++ G LEGA FYSD Sbjct: 120 PIAARIGIDEVLGINLDVSHGVYSGRTVDVLTYREGKITRLLEWLEQAGESLEGAYFYSD 179 Query: 180 SLNDLPLLEKVSRPVAVDPDPRLRAEAEKRGWPI 213 S NDLPLL KV P V+PDP LR AE GWPI Sbjct: 180 SRNDLPLLLKVDYPQVVNPDPVLREHAETAGWPI 213 Lambda K H 0.321 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 217 Length of database: 217 Length adjustment: 22 Effective length of query: 195 Effective length of database: 195 Effective search space: 38025 Effective search space used: 38025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory