GapMind for Amino acid biosynthesis

 

Aligments for a candidate for prs in Pseudomonas simiae WCS417

Align ribose-phosphate diphosphokinase (EC 2.7.6.1) (characterized)
to candidate GFF703 PS417_03575 ribose-phosphate pyrophosphokinase

Query= BRENDA::P0A717
         (315 letters)



>lcl|FitnessBrowser__WCS417:GFF703 PS417_03575 ribose-phosphate
           pyrophosphokinase
          Length = 313

 Score =  426 bits (1094), Expect = e-124
 Identities = 210/313 (67%), Positives = 258/313 (82%), Gaps = 1/313 (0%)

Query: 1   MPDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTC 60
           M  M +F GNA P+LA+R+  +L+  LGD +VG+FSDGE++ +INENVRG D+FIIQ TC
Sbjct: 1   MSKMMVFTGNANPDLARRVVRQLHIPLGDISVGKFSDGEITAEINENVRGKDVFIIQPTC 60

Query: 61  APTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSV 120
           APTNDNLMELVVM DA RR+SA RITAVIPYFGYARQDRR RSARV I+AKVVAD L+ V
Sbjct: 61  APTNDNLMELVVMADAFRRSSATRITAVIPYFGYARQDRRPRSARVAISAKVVADMLTVV 120

Query: 121 GVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAI 180
           G+DRVLTVDLHA+QIQGFFD+PVDN++GSP+L++D+     +N ++VSPDIGGVVRARA+
Sbjct: 121 GIDRVLTVDLHADQIQGFFDIPVDNIYGSPVLVDDIEDQRFENLMIVSPDIGGVVRARAV 180

Query: 181 AKLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERG 240
           AK L   D+ IIDKRR +AN S+VMHIIGDV GR C+LVDDM+DT GTLC AA+ALKE G
Sbjct: 181 AKSLG-VDLGIIDKRREKANHSEVMHIIGDVEGRTCILVDDMVDTAGTLCHAAKALKEHG 239

Query: 241 AKRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAI 300
           A +VFAY THP+ SG A  N+ NSV+DE+VV +TIPLS   ++   +R L ++ ++AEA+
Sbjct: 240 AAKVFAYCTHPVLSGRAIENIENSVLDELVVTNTIPLSAAAQACARIRQLDIAPVVAEAV 299

Query: 301 RRISNEESISAMF 313
           RRISNEESISAMF
Sbjct: 300 RRISNEESISAMF 312


Lambda     K      H
   0.321    0.137    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 359
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 315
Length of database: 313
Length adjustment: 27
Effective length of query: 288
Effective length of database: 286
Effective search space:    82368
Effective search space used:    82368
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate GFF703 PS417_03575 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01251.hmm
# target sequence database:        /tmp/gapView.14740.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01251  [M=309]
Accession:   TIGR01251
Description: ribP_PPkin: ribose-phosphate diphosphokinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
   9.4e-127  408.1   2.8   1.1e-126  407.9   2.8    1.0  1  lcl|FitnessBrowser__WCS417:GFF703  PS417_03575 ribose-phosphate pyr


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__WCS417:GFF703  PS417_03575 ribose-phosphate pyrophosphokinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  407.9   2.8  1.1e-126  1.1e-126       1     309 []       4     313 .]       4     313 .] 0.98

  Alignments for each domain:
  == domain 1  score: 407.9 bits;  conditional E-value: 1.1e-126
                          TIGR01251   1 lkilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmellllidalk 76 
                                        ++++ g+++++la++v ++l+++lgd++v kF+dgE+  +i+e+vrgkdvfii q t+ap+nd+lmel++++da++
  lcl|FitnessBrowser__WCS417:GFF703   4 MMVFTGNANPDLARRVVRQLHIPLGDISVGKFSDGEITAEINENVRGKDVFII-QPTCAPTNDNLMELVVMADAFR 78 
                                        799**************************************************.********************** PP

                          TIGR01251  77 rasaksvtaviPyygYaRqdkkak.srepisaklvaklleeaGadrvltvdlHseqiqgfFdvpvenlsaspklie 151
                                        r+sa ++taviPy+gYaRqd++ +  r +isak+va++l+ +G+drvltvdlH++qiqgfFd+pv+n+++sp+l++
  lcl|FitnessBrowser__WCS417:GFF703  79 RSSATRITAVIPYFGYARQDRRPRsARVAISAKVVADMLTVVGIDRVLTVDLHADQIQGFFDIPVDNIYGSPVLVD 154
                                        *********************97758************************************************** PP

                          TIGR01251 152 elkkkelknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdvegkdvvivDDiisTggTlv 227
                                        +++++  +nl++vsPD G+v ra++vak+lg++l ii+K+R+ k+n+ ev++++gdveg+++++vDD+++T+gTl+
  lcl|FitnessBrowser__WCS417:GFF703 155 DIEDQRFENLMIVSPDIGGVVRARAVAKSLGVDLGIIDKRRE-KANHSEVMHIIGDVEGRTCILVDDMVDTAGTLC 229
                                        ******************************************.899****************************** PP

                          TIGR01251 228 kaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilv.ee.kklpkvseisvapliaeaiarihen 301
                                        +aa++Lke+GA kv++++th+v+sg+A+e++++++++e++vtnti+     +++ +++++++ap++aea++ri+++
  lcl|FitnessBrowser__WCS417:GFF703 230 HAAKALKEHGAAKVFAYCTHPVLSGRAIENIENSVLDELVVTNTIPLsAAaQACARIRQLDIAPVVAEAVRRISNE 305
                                        ***********************************************65579************************ PP

                          TIGR01251 302 esvsslfd 309
                                        es+s++f+
  lcl|FitnessBrowser__WCS417:GFF703 306 ESISAMFR 313
                                        ******95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (309 nodes)
Target sequences:                          1  (313 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.77
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory