Align 3-isopropylmalate dehydratase large subunit; EC 4.2.1.33; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase (uncharacterized)
to candidate GFF2930 PS417_14990 bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase
Query= curated2:B2V844 (431 letters) >lcl|FitnessBrowser__WCS417:GFF2930 PS417_14990 bifunctional aconitate hydratase 2/2-methylisocitrate dehydratase Length = 869 Score = 101 bits (251), Expect = 1e-25 Identities = 127/474 (26%), Positives = 195/474 (41%), Gaps = 75/474 (15%) Query: 2 GMTITEKIIAAHAGRDY---VEPGELVTVKVDLAIANDITAPLAIKQLEKYGIDKVHDPN 58 G T+ +K++ G V PG K+ + D T P+ +L+ D Sbjct: 381 GFTLAQKMVGKACGLPEGKGVRPGTYCEPKMTTVGSQDTTGPMTRDELK----DLACLGF 436 Query: 59 KIALVMDHF-----FP-PKDIMSAQQIKISRDFAKKMGIKNYFEGQDSGVMHTLLPEKGF 112 LVM F +P P D+ + + DF G + G G++H+ L Sbjct: 437 STDLVMQSFCHTAAYPKPIDVTTHHTLP---DFIMTRGGVSLRPGD--GIIHSWLNR--M 489 Query: 113 VVPGDLVIGADSHTCTYGGIGAFSTGVGSTDIAYIWATGETWLRVPESMKFVFYNKPQKW 172 ++P + G DSHT GI S GS +A+ ATG L +PES+ F K + Sbjct: 490 LLPDTVGTGGDSHTRFPMGI---SFPAGSGLVAFAAATGVMPLDMPESILVRFKGKMKPG 546 Query: 173 VGGKDFV-----------LTVIGKIGVDGALY-KAMEYQGEAIRALDIDNRLTIANMAIE 220 + +D V L + K G A + +E +G L+ L+ A+ Sbjct: 547 ITLRDLVHAIPYYAIQSGLLTVEKKGKKNAFSGRILEIEGLNDLTLEQAFELSDASAERS 606 Query: 221 AGG------KSGIIE-----------------PDEKTVD--------WVRKRTNREFKLY 249 A G K I E D +T++ WV+ +L Sbjct: 607 AAGCTIKLSKESITEYLNSNITLLRWMIGEGYGDPRTLERRAQAMEAWVKNP-----ELM 661 Query: 250 KSDPDAKYCCEYEFDASKI-EPVVACPSLPSNVKPVSEVAGTHIDQVFIGSCTNGRLSDL 308 ++D DA+Y E D ++I EP++ P+ P + + +S VAG ID+VFIGSC + Sbjct: 662 EADADAEYAEIIEIDLAEINEPILCAPNDPDDARLLSSVAGEKIDEVFIGSCMT-NIGHF 720 Query: 309 RIAAAILKSKKVHPEVRCIVIPASDQIYKQALHEGIIEILADAGCLISTSTCGPCLGGHM 368 R A +L+ K R + P + Q EG I AG + C C+G Sbjct: 721 RAAGKLLEQVKGQLPTRLWLSPPTKMDAHQLTEEGYYGIYGKAGARMEMPGCSLCMGNQA 780 Query: 369 GILAEGEVCLSTSNRNFVGRMGHPKSQVYLSSPAVAAASAVLGRIAHPDEVAKY 422 + V +STS RNF R+G + VYL+S +AA ++ LGR+ +E Y Sbjct: 781 RVEPNSTV-VSTSTRNFPNRLG-DGANVYLASAELAAVASTLGRLPTVEEYMGY 832 Lambda K H 0.319 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 852 Number of extensions: 41 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 431 Length of database: 869 Length adjustment: 37 Effective length of query: 394 Effective length of database: 832 Effective search space: 327808 Effective search space used: 327808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory