GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapE in Pseudomonas simiae WCS417

Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate GFF1211 PS417_06155 succinyl-diaminopimelate desuccinylase

Query= BRENDA::Q9KQ52
         (377 letters)



>lcl|FitnessBrowser__WCS417:GFF1211 PS417_06155
           succinyl-diaminopimelate desuccinylase
          Length = 383

 Score =  458 bits (1178), Expect = e-133
 Identities = 230/375 (61%), Positives = 277/375 (73%), Gaps = 2/375 (0%)

Query: 4   SPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQS-PL 62
           SP L LA +LI R SVTP DA CQ LM++RL   GF +E M  ED  NFWA  G    P+
Sbjct: 8   SPTLQLAIDLIRRPSVTPIDADCQKLMMQRLGDAGFALEPMRIEDVDNFWATHGKHDGPV 67

Query: 63  FVFAGHTDVVPAGPLSQWHTPPFEPTVID-GFLHGRGAADMKGSLACMIVAVERFIAEHP 121
             FAGHTDVVP GP+  W   PF+  + + G L GRGAADMKGSLA M+VA ERF+ ++P
Sbjct: 68  LCFAGHTDVVPTGPVQAWQNDPFDALIDENGMLCGRGAADMKGSLAAMLVAAERFVTDYP 127

Query: 122 DHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRRG 181
           DH+GS+ FLITSDEEGP  +GT  V+E L AR E +D CIVGEPSST  VGDVVKNGRRG
Sbjct: 128 DHKGSVAFLITSDEEGPAHHGTKAVIERLAARKERLDWCIVGEPSSTTLVGDVVKNGRRG 187

Query: 182 SITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQAG 241
           S+   L V+G QGHVAYPHLA NP+H A PALAELAA  WD+GNA+FPPTSFQI NL +G
Sbjct: 188 SLGATLTVRGIQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQISNLNSG 247

Query: 242 TGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTGE 301
           TGA+NVIPG+    FNFRFSTE T E +++RV  +LD HGLD+ V+W LSG PFLT+ G 
Sbjct: 248 TGATNVIPGDLKAVFNFRFSTESTVEGLQQRVAEILDKHGLDWHVEWALSGLPFLTEPGA 307

Query: 302 LLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADL 361
           LL AV A+++ +  +     T+GGTSDGRFIA +G QVVELGPVNATIH+VNE +  +DL
Sbjct: 308 LLDAVSASIKAITGRETQASTSGGTSDGRFIATLGTQVVELGPVNATIHQVNERILASDL 367

Query: 362 EKLTDMYQKTLNHLL 376
           + LT++Y +TL  LL
Sbjct: 368 DVLTEIYYQTLIKLL 382


Lambda     K      H
   0.318    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 517
Number of extensions: 24
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 377
Length of database: 383
Length adjustment: 30
Effective length of query: 347
Effective length of database: 353
Effective search space:   122491
Effective search space used:   122491
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate GFF1211 PS417_06155 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01246.hmm
# target sequence database:        /tmp/gapView.9832.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01246  [M=370]
Accession:   TIGR01246
Description: dapE_proteo: succinyl-diaminopimelate desuccinylase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   5.4e-166  538.1   0.0   6.2e-166  537.9   0.0    1.0  1  lcl|FitnessBrowser__WCS417:GFF1211  PS417_06155 succinyl-diaminopime


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__WCS417:GFF1211  PS417_06155 succinyl-diaminopimelate desuccinylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  537.9   0.0  6.2e-166  6.2e-166       2     370 .]      11     381 ..      10     381 .. 0.98

  Alignments for each domain:
  == domain 1  score: 537.9 bits;  conditional E-value: 6.2e-166
                           TIGR01246   2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgt.eepvlvfaGhtDvvPaGelekW 75 
                                         l+la++Li+r+svtP da++q+l+++rL   gf+ e +++ed+ n+wat+g  + pvl+faGhtDvvP+G++++W
  lcl|FitnessBrowser__WCS417:GFF1211  11 LQLAIDLIRRPSVTPIDADCQKLMMQRLGDAGFALEPMRIEDVDNFWATHGKhDGPVLCFAGHTDVVPTGPVQAW 85 
                                         5899**********************************************98789******************** PP

                           TIGR01246  76 ssdpfepee.rdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerd 149
                                         ++dpf++ + ++G+l grGaaDmkgslaa++vaaerfv++++dhkGs+++litsDeeg a +Gtk+v+e l +r+
  lcl|FitnessBrowser__WCS417:GFF1211  86 QNDPFDALIdENGMLCGRGAADMKGSLAAMLVAAERFVTDYPDHKGSVAFLITSDEEGPAHHGTKAVIERLAARK 160
                                         *****9876267*************************************************************** PP

                           TIGR01246 150 elidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffp 224
                                         e +d+++vgePss+  +GDv+k+GrrGs+ ++l+++GiqGhvaYPh+a+nP+h a+p+l+el+a+++D+Gn+ffp
  lcl|FitnessBrowser__WCS417:GFF1211 161 ERLDWCIVGEPSSTTLVGDVVKNGRRGSLGATLTVRGIQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFP 235
                                         *************************************************************************** PP

                           TIGR01246 225 psslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklik 299
                                         p+s+qi+n+++gtga+nviPg+lk+ fn+rfs+e+++e l+++v++ildkh+ld+++ew lsg pflt+ g l++
  lcl|FitnessBrowser__WCS417:GFF1211 236 PTSFQISNLNSGTGATNVIPGDLKAVFNFRFSTESTVEGLQQRVAEILDKHGLDWHVEWALSGLPFLTEPGALLD 310
                                         *************************************************************************** PP

                           TIGR01246 300 kvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklleel 370
                                         +v ++i+ ++++++++stsGGtsD+rfia+lg++vvelG+vn+tih+vne++  +dl+ l+e+y+++l++l
  lcl|FitnessBrowser__WCS417:GFF1211 311 AVSASIKAITGRETQASTSGGTSDGRFIATLGTQVVELGPVNATIHQVNERILASDLDVLTEIYYQTLIKL 381
                                         ******************************************************************99876 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (370 nodes)
Target sequences:                          1  (383 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 10.73
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory