Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate GFF1211 PS417_06155 succinyl-diaminopimelate desuccinylase
Query= BRENDA::Q9KQ52 (377 letters) >lcl|FitnessBrowser__WCS417:GFF1211 PS417_06155 succinyl-diaminopimelate desuccinylase Length = 383 Score = 458 bits (1178), Expect = e-133 Identities = 230/375 (61%), Positives = 277/375 (73%), Gaps = 2/375 (0%) Query: 4 SPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQS-PL 62 SP L LA +LI R SVTP DA CQ LM++RL GF +E M ED NFWA G P+ Sbjct: 8 SPTLQLAIDLIRRPSVTPIDADCQKLMMQRLGDAGFALEPMRIEDVDNFWATHGKHDGPV 67 Query: 63 FVFAGHTDVVPAGPLSQWHTPPFEPTVID-GFLHGRGAADMKGSLACMIVAVERFIAEHP 121 FAGHTDVVP GP+ W PF+ + + G L GRGAADMKGSLA M+VA ERF+ ++P Sbjct: 68 LCFAGHTDVVPTGPVQAWQNDPFDALIDENGMLCGRGAADMKGSLAAMLVAAERFVTDYP 127 Query: 122 DHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRRG 181 DH+GS+ FLITSDEEGP +GT V+E L AR E +D CIVGEPSST VGDVVKNGRRG Sbjct: 128 DHKGSVAFLITSDEEGPAHHGTKAVIERLAARKERLDWCIVGEPSSTTLVGDVVKNGRRG 187 Query: 182 SITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQAG 241 S+ L V+G QGHVAYPHLA NP+H A PALAELAA WD+GNA+FPPTSFQI NL +G Sbjct: 188 SLGATLTVRGIQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQISNLNSG 247 Query: 242 TGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTGE 301 TGA+NVIPG+ FNFRFSTE T E +++RV +LD HGLD+ V+W LSG PFLT+ G Sbjct: 248 TGATNVIPGDLKAVFNFRFSTESTVEGLQQRVAEILDKHGLDWHVEWALSGLPFLTEPGA 307 Query: 302 LLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADL 361 LL AV A+++ + + T+GGTSDGRFIA +G QVVELGPVNATIH+VNE + +DL Sbjct: 308 LLDAVSASIKAITGRETQASTSGGTSDGRFIATLGTQVVELGPVNATIHQVNERILASDL 367 Query: 362 EKLTDMYQKTLNHLL 376 + LT++Y +TL LL Sbjct: 368 DVLTEIYYQTLIKLL 382 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 383 Length adjustment: 30 Effective length of query: 347 Effective length of database: 353 Effective search space: 122491 Effective search space used: 122491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF1211 PS417_06155 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.9832.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-166 538.1 0.0 6.2e-166 537.9 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF1211 PS417_06155 succinyl-diaminopime Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF1211 PS417_06155 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 537.9 0.0 6.2e-166 6.2e-166 2 370 .] 11 381 .. 10 381 .. 0.98 Alignments for each domain: == domain 1 score: 537.9 bits; conditional E-value: 6.2e-166 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgt.eepvlvfaGhtDvvPaGelekW 75 l+la++Li+r+svtP da++q+l+++rL gf+ e +++ed+ n+wat+g + pvl+faGhtDvvP+G++++W lcl|FitnessBrowser__WCS417:GFF1211 11 LQLAIDLIRRPSVTPIDADCQKLMMQRLGDAGFALEPMRIEDVDNFWATHGKhDGPVLCFAGHTDVVPTGPVQAW 85 5899**********************************************98789******************** PP TIGR01246 76 ssdpfepee.rdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerd 149 ++dpf++ + ++G+l grGaaDmkgslaa++vaaerfv++++dhkGs+++litsDeeg a +Gtk+v+e l +r+ lcl|FitnessBrowser__WCS417:GFF1211 86 QNDPFDALIdENGMLCGRGAADMKGSLAAMLVAAERFVTDYPDHKGSVAFLITSDEEGPAHHGTKAVIERLAARK 160 *****9876267*************************************************************** PP TIGR01246 150 elidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffp 224 e +d+++vgePss+ +GDv+k+GrrGs+ ++l+++GiqGhvaYPh+a+nP+h a+p+l+el+a+++D+Gn+ffp lcl|FitnessBrowser__WCS417:GFF1211 161 ERLDWCIVGEPSSTTLVGDVVKNGRRGSLGATLTVRGIQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFP 235 *************************************************************************** PP TIGR01246 225 psslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklik 299 p+s+qi+n+++gtga+nviPg+lk+ fn+rfs+e+++e l+++v++ildkh+ld+++ew lsg pflt+ g l++ lcl|FitnessBrowser__WCS417:GFF1211 236 PTSFQISNLNSGTGATNVIPGDLKAVFNFRFSTESTVEGLQQRVAEILDKHGLDWHVEWALSGLPFLTEPGALLD 310 *************************************************************************** PP TIGR01246 300 kvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklleel 370 +v ++i+ ++++++++stsGGtsD+rfia+lg++vvelG+vn+tih+vne++ +dl+ l+e+y+++l++l lcl|FitnessBrowser__WCS417:GFF1211 311 AVSASIKAITGRETQASTSGGTSDGRFIATLGTQVVELGPVNATIHQVNERILASDLDVLTEIYYQTLIKL 381 ******************************************************************99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (383 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.73 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory