Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; EC 2.3.1.89; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase (uncharacterized)
to candidate GFF1613 PS417_08205 acetyltransferase
Query= curated2:Q9K9H8 (240 letters) >FitnessBrowser__WCS417:GFF1613 Length = 214 Score = 65.1 bits (157), Expect = 1e-15 Identities = 39/127 (30%), Positives = 67/127 (52%), Gaps = 11/127 (8%) Query: 103 QVEIGDNAVIMMGASINIGSVIGEGTMIDMNVVLGGRATVGKNCHIG-AGSVLAGVIEPP 161 QV+IG+N AS ++ I NV++G + + + H +G + E P Sbjct: 85 QVDIGEN----FSASDHLHIACCNKITIGRNVLMGSKIHITDHSHGAYSGENQSSPYETP 140 Query: 162 ------SAKPVVVEDDVVIGANCVILEGVTVGKGAVVAAGAVVTEDVPPNTVVAGTPARV 215 S+ PV + D+V IG N V+L ++G G+++ A ++VT+D+P + + G PARV Sbjct: 141 FERKLASSGPVTIGDNVWIGDNVVVLPNTSIGNGSIIGANSIVTKDIPSHVIAVGCPARV 200 Query: 216 IKEIDEK 222 +K +K Sbjct: 201 VKVWSDK 207 Score = 32.3 bits (72), Expect = 8e-06 Identities = 14/35 (40%), Positives = 22/35 (62%) Query: 100 IRDQVEIGDNAVIMMGASINIGSVIGEGTMIDMNV 134 I D V IGDN V++ SI GS+IG +++ ++ Sbjct: 153 IGDNVWIGDNVVVLPNTSIGNGSIIGANSIVTKDI 187 Lambda K H 0.314 0.135 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 240 Length of database: 214 Length adjustment: 22 Effective length of query: 218 Effective length of database: 192 Effective search space: 41856 Effective search space used: 41856 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory