Align aromatic-amino-acid transaminase TyrB; EC 2.6.1.57 (characterized)
to candidate GFF3652 PS417_18690 aromatic amino acid aminotransferase
Query= CharProtDB::CH_004054 (397 letters) >FitnessBrowser__WCS417:GFF3652 Length = 398 Score = 419 bits (1076), Expect = e-122 Identities = 209/397 (52%), Positives = 277/397 (69%), Gaps = 1/397 (0%) Query: 1 MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLNAQP 60 +F V+ DPIL L E F D R+ KVNL +G+Y NE+G IP L+AVAEAEA AQ Sbjct: 3 LFSAVEMAPRDPILGLNEAFNADTRTTKVNLGVGVYCNEEGKIPLLRAVAEAEAIRVAQ- 61 Query: 61 HGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFP 120 H A YLP++G+ Y A+ LLFGA+ P+L RV T+Q +GG+GALK+GADFLK+ P Sbjct: 62 HAARGYLPIDGIAAYDKAVQTLLFGAESPLLNADRVTTVQAVGGTGALKLGADFLKQLLP 121 Query: 121 ESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLHP 180 ++ V +SDP+WENH A+F AGF V Y +YD AT+ V LL L LP++SIV+LH Sbjct: 122 DAVVAISDPSWENHRALFETAGFPVQNYRYYDAATHDVNRAGLLEDLNALPSQSIVVLHA 181 Query: 181 CCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPAL 240 CCHNPTG DL+ W V++++KA+ L+PFLD+AYQGFG G+ EDA A+R A +GL Sbjct: 182 CCHNPTGVDLSPADWQNVLDVIKAKNLVPFLDMAYQGFGDGIHEDAAAVRLFAESGLTFF 241 Query: 241 VSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLN 300 VS+SFSK FSLYGERVG LS++ + E + R+L Q+K +R NYS+PP GA +VAAVLN Sbjct: 242 VSSSFSKSFSLYGERVGALSIVGDSKEESARILSQVKRVIRTNYSNPPTHGAAIVAAVLN 301 Query: 301 DEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVD 360 + L+A W AE+ EMR RI MR+++V L+ P +F ++ QRGMFSY+GL+ QV Sbjct: 302 NPELRAQWEAELAEMRLRIRGMREQMVAELAKAAPGHDFSFVGRQRGMFSYSGLTVEQVT 361 Query: 361 RLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397 RLR EFG+Y + +GR+CVA LN +N+ V KA V+ Sbjct: 362 RLRSEFGIYALDTGRICVAALNQSNIDAVTKAIVQVL 398 Lambda K H 0.320 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 398 Length adjustment: 31 Effective length of query: 366 Effective length of database: 367 Effective search space: 134322 Effective search space used: 134322 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory