Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate GFF3695 PS417_18910 acetylornithine deacetylase
Query= BRENDA::Q92Y75 (374 letters) >FitnessBrowser__WCS417:GFF3695 Length = 385 Score = 274 bits (700), Expect = 3e-78 Identities = 143/373 (38%), Positives = 217/373 (58%), Gaps = 8/373 (2%) Query: 1 MQAAEILGKLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKE 60 M + E+L +LV F + N ++ ++R YL+ HG+A ++ ++N+ ATIGP E Sbjct: 1 MNSRELLAQLVRFDTTSRESNLALIDFVRTYLQDHGVACALVYNEHKSKANLLATIGPAE 60 Query: 61 ARGYIISGHMDVVPAAETGWTSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMP 120 G ++SGH DVVP W+ PF L + +LYGRGT DMKG++A VLA VP L Sbjct: 61 VPGIVLSGHTDVVPVEGQRWSVAPFDLTEKDGKLYGRGTADMKGYIACVLACVPALVKAS 120 Query: 121 LRRPLHLALSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLT 180 LR P+H+ALSYDEE GC GV +I R E +PL +IGEPT ++ + HKGK A R Sbjct: 121 LRMPVHIALSYDEEVGCLGVRSLIERFHEQPVKPLLCVIGEPTELKPVLGHKGKLAMRCH 180 Query: 181 VRGRSGHSSRPDQGLNAIHGVAGVLTQAVAEADRLVGGP-FEHVFEPPYSSLQIGTVKGG 239 V G + HS+ G+NAI A ++++ V + L + F P +S++Q G + GG Sbjct: 181 VHGAACHSAYAPAGVNAIEYAACLISELVRLGETLKAPQHLDQRFAPAFSTVQTGLINGG 240 Query: 240 QAVNIIPDSCEVEFEARAISGVDPAELLAPVRKTAE-----ALTTLGFE--VEWQELSAY 292 +A+NI+P C +FE R++ DP ++ ++ AE A+ + + + ELS+Y Sbjct: 241 KALNIVPQDCSFDFEVRSLPAQDPWQVARQLQAYAEQTLLPAMRAVSEQSAISLSELSSY 300 Query: 293 PALSLEPDAPLAALLEELTGREALPAVSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEY 352 P L+ ++ A + + G V++GTE GLF +AGI ++CGPG + + HKPDE+ Sbjct: 301 PGLATSLESQAAEWVAQFCGSREFATVAFGTEGGLFDQAGIPTVVCGPGSMEQGHKPDEF 360 Query: 353 ILIDELMACRAMV 365 I + +L AC M+ Sbjct: 361 ISVAQLQACDRML 373 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 352 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 385 Length adjustment: 30 Effective length of query: 344 Effective length of database: 355 Effective search space: 122120 Effective search space used: 122120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF3695 PS417_18910 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.2452.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-124 399.6 0.0 7.4e-124 399.4 0.0 1.0 1 lcl|FitnessBrowser__WCS417:GFF3695 PS417_18910 acetylornithine deac Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__WCS417:GFF3695 PS417_18910 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 399.4 0.0 7.4e-124 7.4e-124 1 364 [. 5 376 .. 5 377 .. 0.96 Alignments for each domain: == domain 1 score: 399.4 bits; conditional E-value: 7.4e-124 TIGR01892 1 eilakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtDvvPvde 75 e+la+Lv fd++s+ sn++li++v+ yl+++gva + + + k nlla+iGp+e g+vlsGhtDvvPv++ lcl|FitnessBrowser__WCS417:GFF3695 5 ELLAQLVRFDTTSRESNLALIDFVRTYLQDHGVACALVYNEHK-SKANLLATIGPAE-VPGIVLSGHTDVVPVEG 77 6799*******************************99988877.************9.9**************** PP TIGR01892 76 aaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGakklieala...r 147 ++W+ pf Ltekdg+LYgrGtaDmkG++a+vLa vp l +a L+ P+h++ls+Deevg++G+++lie+ lcl|FitnessBrowser__WCS417:GFF3695 78 QRWSVAPFDLTEKDGKLYGRGTADMKGYIACVLACVPALVKASLRMPVHIALSYDEEVGCLGVRSLIERFHeqpV 152 *********************************************************************986668 PP TIGR01892 148 rpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlvaladklkr.edleeaFtp 221 +p l ++GePt+l++v hkGk +++ +v+G hs+++ Gv+aie aa l+++lv+l ++lk ++l++ F p lcl|FitnessBrowser__WCS417:GFF3695 153 KPLLCVIGEPTELKPVLGHKGKLAMRCHVHGAACHSAYAPAGVNAIEYAACLISELVRLGETLKApQHLDQRFAP 227 8999************************************************************98999****** PP TIGR01892 222 pyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaee.....vkekapgfevkveelsatpa 291 ++t++ G ++GGka ni+++ C + +e+R++p +dp ++ +l++ ae+ +++ + + els +p+ lcl|FitnessBrowser__WCS417:GFF3695 228 AFSTVQTGLINGGKALNIVPQDCSFDFEVRSLPAQDPWQVARQLQAYAEQtllpaMRAVSEQSAISLSELSSYPG 302 **********************************************99987777555555566778999****** PP TIGR01892 292 leleedaelvalleklaGa.aaevvsygteagllqelGieavvlGPGdidqahqpdeYveieelkrcrallerl 364 l++ ++++++ +++ G+ + +v++gte gl+ ++Gi++vv+GPG+++q h+pde++ + +l++c+ +l+r+ lcl|FitnessBrowser__WCS417:GFF3695 303 LATSLESQAAEWVAQFCGSrEFATVAFGTEGGLFDQAGIPTVVCGPGSMEQGHKPDEFISVAQLQACDRMLARV 376 ******************9899*************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (385 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.70 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory