GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvD in Pseudomonas simiae WCS417

Align dihydroxyacid dehydratase (characterized)
to candidate GFF5251 PS417_26890 dihydroxy-acid dehydratase

Query= CharProtDB::CH_024768
         (616 letters)



>lcl|FitnessBrowser__WCS417:GFF5251 PS417_26890 dihydroxy-acid
           dehydratase
          Length = 613

 Score =  917 bits (2371), Expect = 0.0
 Identities = 460/617 (74%), Positives = 520/617 (84%), Gaps = 6/617 (0%)

Query: 1   MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGKLV 60
           MP YRS T+THGRNMAGARALWRATGM D DF KPIIA+ NSFTQFVPGHVHL+DLG+LV
Sbjct: 1   MPDYRSKTSTHGRNMAGARALWRATGMKDDDFKKPIIAIANSFTQFVPGHVHLKDLGQLV 60

Query: 61  AEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAMVCIS 120
           A +IE AGGVAKEFNTIAVDDGIAMGH GMLYSLPSRE+IADSVEYMVNAHCADA+VCIS
Sbjct: 61  AREIERAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSREIIADSVEYMVNAHCADAIVCIS 120

Query: 121 NCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDQIIKLDLVDAMIQGADPKVSDSQ 180
           NCDKITPGMLMA+LRLNIPVIFVSGGPMEAGKTKL+     LDLVDAM+  AD   SD +
Sbjct: 121 NCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTKLASH--GLDLVDAMVIAADSSASDEK 178

Query: 181 SDQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIV 240
             + ERSACPTCGSCSGMFTANSMNCL EALGL+ PGNGS LATH+DR+QLFL AG+ IV
Sbjct: 179 VAEYERSACPTCGSCSGMFTANSMNCLVEALGLALPGNGSTLATHSDREQLFLQAGRTIV 238

Query: 241 ELTKRYYEQNDESALPRNIASKAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEIDFTMSD 300
           EL KRYY +NDES LPRNIA+  AFENAMTLDIAMGGSTNT+LHLLAAAQEAEI+F + D
Sbjct: 239 ELCKRYYGENDESVLPRNIANFKAFENAMTLDIAMGGSTNTILHLLAAAQEAEIEFDLRD 298

Query: 301 IDKLSRKVPQLCKVAPSTQKYHMEDVHRAGGVIGILGELDRAGLLNRDVKNVLGLTLPQT 360
           ID+LSR VPQLCKVAP+ QKYHMEDVHRAGG+  ILG L R GLL+ D+  V   ++ + 
Sbjct: 299 IDRLSRHVPQLCKVAPNIQKYHMEDVHRAGGIFSILGSLARGGLLHTDLPTVHSKSIAEG 358

Query: 361 LEQYDVMLTQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRANGCIRSLEHAYSKDG 420
           + ++D+  T D+AV   F+AGPAGI T  AFSQ  RWDTLDDDR NGCIRS+EHAYSK+G
Sbjct: 359 IAKWDITQTDDEAVHTFFKAGPAGIPTQTAFSQSTRWDTLDDDRENGCIRSVEHAYSKEG 418

Query: 421 GLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQDDAVEAILGGKVVAGDVVVIRY 480
           GLAVLYGN A +GC+VKTAGVD+SI  F G AK++ESQD AV  IL  +V AGD+V+IRY
Sbjct: 419 GLAVLYGNIALDGCVVKTAGVDESIHVFEGNAKIFESQDSAVRGILADEVKAGDIVIIRY 478

Query: 481 EGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASGGSIGL 540
           EGPKGGPGMQEMLYPTS+LKS GLGKACAL+TDGRFSGGTSGLSIGH SPEAA+GG+IGL
Sbjct: 479 EGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAAGGAIGL 538

Query: 541 IEDGDLIAIDIPNRGIQLQVSDAELAARREAQDARGDKAWTP-KNRERQVSFALRAYASL 599
           ++DGD + IDIPNR I L +SD ELAARR  QD +G   W P + R R+V+ AL+AYA L
Sbjct: 539 VQDGDKVLIDIPNRSINLLISDEELAARRVEQDKKG---WKPVEKRPRKVTTALKAYALL 595

Query: 600 ATSADKGAVRDKSKLGG 616
           ATSADKGAVR+K+ L G
Sbjct: 596 ATSADKGAVRNKAMLDG 612


Lambda     K      H
   0.317    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1220
Number of extensions: 48
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 616
Length of database: 613
Length adjustment: 37
Effective length of query: 579
Effective length of database: 576
Effective search space:   333504
Effective search space used:   333504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

Align candidate GFF5251 PS417_26890 (dihydroxy-acid dehydratase)
to HMM TIGR00110 (ilvD: dihydroxy-acid dehydratase (EC 4.2.1.9))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00110.hmm
# target sequence database:        /tmp/gapView.10754.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00110  [M=543]
Accession:   TIGR00110
Description: ilvD: dihydroxy-acid dehydratase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                           Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                           -----------
   5.2e-255  833.0   1.3   6.2e-255  832.8   1.3    1.0  1  lcl|FitnessBrowser__WCS417:GFF5251  PS417_26890 dihydroxy-acid dehyd


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__WCS417:GFF5251  PS417_26890 dihydroxy-acid dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  832.8   1.3  6.2e-255  6.2e-255       2     542 ..      18     606 ..      17     607 .. 0.98

  Alignments for each domain:
  == domain 1  score: 832.8 bits;  conditional E-value: 6.2e-255
                           TIGR00110   2 arallkatGlkdedlekPiiavvnsyteivPghvhlkdlaklvkeeieaaGgvakefntiavsDGiamgheGmky 76 
                                         aral++atG+kd+d++kPiia++ns+t++vPghvhlkdl++lv++eie+aGgvakefntiav+DGiamgh+Gm+y
  lcl|FitnessBrowser__WCS417:GFF5251  18 ARALWRATGMKDDDFKKPIIAIANSFTQFVPGHVHLKDLGQLVAREIERAGGVAKEFNTIAVDDGIAMGHDGMLY 92 
                                         79************************************************************************* PP

                           TIGR00110  77 sLpsreiiaDsvetvvkahalDalvvissCDkivPGmlmaalrlniPaivvsGGpmeagktklsekidlvdvfea 151
                                         sLpsreiiaDsve++v+ah++Da+v+is+CDki+PGmlmaalrlniP+i+vsGGpmeagktkl    + +d+++a
  lcl|FitnessBrowser__WCS417:GFF5251  93 SLPSREIIADSVEYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTKL--ASHGLDLVDA 165
                                         **************************************************************8..557899**** PP

                           TIGR00110 152 vgeyaagklseeeleeiersacPtagsCsGlftansmacltealGlslPgsstllatsaekkelakksgkrivel 226
                                         ++ +a++  s+e++ e+ersacPt+gsCsG+ftansm+cl ealGl+lPg++++lat++++++l+ ++g++ivel
  lcl|FitnessBrowser__WCS417:GFF5251 166 MVIAADSSASDEKVAEYERSACPTCGSCSGMFTANSMNCLVEALGLALPGNGSTLATHSDREQLFLQAGRTIVEL 240
                                         *************************************************************************** PP

                           TIGR00110 227 vkknik.......PrdiltkeafenaitldlalGGstntvLhllaiakeagvklslddfdrlsrkvPllaklkPs 294
                                         +k+++        Pr+i++ +afena+tld+a+GGstnt+Lhlla+a+ea+++++l d+drlsr+vP+l+k++P+
  lcl|FitnessBrowser__WCS417:GFF5251 241 CKRYYGendesvlPRNIANFKAFENAMTLDIAMGGSTNTILHLLAAAQEAEIEFDLRDIDRLSRHVPQLCKVAPN 315
                                         *****99999***************************************************************** PP

                           TIGR00110 295 gkkv.iedlhraGGvsavlkeldkegllhkdaltvtGktlaetlekvkvlr........................ 344
                                          +k+ +ed+hraGG+ ++l++l + gllh+d  tv  k++ae ++k ++++                        
  lcl|FitnessBrowser__WCS417:GFF5251 316 IQKYhMEDVHRAGGIFSILGSLARGGLLHTDLPTVHSKSIAEGIAKWDITQtddeavhtffkagpagiptqtafs 390
                                         *9999********************************************999*********************** PP

                           TIGR00110 345 ...........vdqdvirsldnpvkkegglavLkGnlaeeGavvkiagveedilkfeGpakvfeseeealeailg 408
                                                     ++ +irs++++++kegglavL+Gn+a +G+vvk+agv+e+i +feG+ak+fes++ a+ +il+
  lcl|FitnessBrowser__WCS417:GFF5251 391 qstrwdtldddRENGCIRSVEHAYSKEGGLAVLYGNIALDGCVVKTAGVDESIHVFEGNAKIFESQDSAVRGILA 465
                                         *******77555555************************************************************ PP

                           TIGR00110 409 gkvkeGdvvviryeGPkGgPGmremLaPtsalvglGLgkkvaLitDGrfsGgtrGlsiGhvsPeaaegGaialve 483
                                          +vk+Gd+v+iryeGPkGgPGm+emL+Pts+l++ GLgk++aL+tDGrfsGgt+GlsiGh sPeaa+gGai+lv+
  lcl|FitnessBrowser__WCS417:GFF5251 466 DEVKAGDIVIIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALLTDGRFSGGTSGLSIGHASPEAAAGGAIGLVQ 540
                                         *************************************************************************** PP

                           TIGR00110 484 dGDkikiDienrkldlevseeelaerrakakkkea.......revkgaLakyaklvssadkGavld 542
                                         dGDk+ iDi+nr ++l +s+eela+rr +++kk++       r+v  aL++ya l++sadkGav++
  lcl|FitnessBrowser__WCS417:GFF5251 541 DGDKVLIDIPNRSINLLISDEELAARRVEQDKKGWkpvekrpRKVTTALKAYALLATSADKGAVRN 606
                                         **********************************999**99999********************87 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (543 nodes)
Target sequences:                          1  (613 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 11.80
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory