Align N-acetylglutamylphosphate reductase (EC 1.2.1.38) (characterized)
to candidate Ac3H11_1253 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)
Query= reanno::Smeli:SMc01801 (310 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1253 Length = 310 Score = 269 bits (688), Expect = 5e-77 Identities = 146/314 (46%), Positives = 198/314 (63%), Gaps = 17/314 (5%) Query: 4 KIFIDGEHGTTGLQIRVRMAGRTDLELLSIPEAERRNAAMREDLLNSADIAILCLPDDAS 63 K+FIDGE GTTGLQIR R+ +EL+SI R++ A + DL+ D+ +LCL DDA+ Sbjct: 3 KVFIDGEAGTTGLQIRERLQAMPQIELVSIAPELRKDPAAKRDLIAGVDLVVLCLHDDAA 62 Query: 64 REAVAMV-----AGNNRVRIIDTSTAHRVAPDWAYGFAEMDKAQPQRIRDARHVANPGCY 118 R+ VAMV + +V++ID STAHR A W YGF E+ +Q Q +RDA V+NPGCY Sbjct: 63 RDTVAMVDEIERSSGRKVKVIDASTAHRTADGWVYGFPELAASQTQAVRDATRVSNPGCY 122 Query: 119 PTGAIALIRPLRQAGILPDGYPVTVNAVSGYTGGGKQMIAQMEDDQNPDHIGAPHFLYGL 178 TGAIA++RPL AG++P YP+++ +VSGY+GGG+ MI E AP+ Y L Sbjct: 123 ATGAIAMLRPLVDAGLIPADYPLSLPSVSGYSGGGRTMIEAYEAG-----TAAPYEAYAL 177 Query: 179 TLKHKHVPEMKMHGLLERAPVFSPSVGKFAQGMIVQVPLYLEDLAAGATLETIHRALVDH 238 L HKH+PE+ + L R PVF P+VG F QGM+VQ+PL+L+ L +H AL H Sbjct: 178 GLSHKHIPEILRYTGLTRRPVFIPAVGNFRQGMLVQLPLHLDLLPGAPKASDLHDALASH 237 Query: 239 YA----GQSIVEVVPLDESAKLARIDATELAGSDAMKLFVFGTKGGAHVNLVALLDNLGK 294 Y+ + V V+P + KLA A L ++ ++L VF + ++A LDNLGK Sbjct: 238 YSHTNTPEQWVSVLPPTDDLKLA---ADTLTDTNKLELRVFANEQYRQAVVIARLDNLGK 294 Query: 295 GASGAAVQNMDLML 308 GASGAAVQN+ LML Sbjct: 295 GASGAAVQNLQLML 308 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 310 Length adjustment: 27 Effective length of query: 283 Effective length of database: 283 Effective search space: 80089 Effective search space used: 80089 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate Ac3H11_1253 (N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
to HMM TIGR01851 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01851.hmm # target sequence database: /tmp/gapView.20324.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01851 [M=310] Accession: TIGR01851 Description: argC_other: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-121 391.5 0.0 1.6e-121 391.3 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1253 N-acetyl-gamma-glutamyl-phosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1253 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 391.3 0.0 1.6e-121 1.6e-121 2 310 .] 2 310 .] 1 310 [] 0.94 Alignments for each domain: == domain 1 score: 391.3 bits; conditional E-value: 1.6e-121 TIGR01851 2 pkvfidGeaGttGlqirerlaerddlellsidedkrkdaderakllnaadvailclpddaar 63 kvfidGeaGttGlqirerl+ +el+si+++ rkd++++ +l+ +d ++lcl+ddaar lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1253 2 SKVFIDGEAGTTGLQIRERLQAMPQIELVSIAPELRKDPAAKRDLIAGVDLVVLCLHDDAAR 63 59************************************************************ PP TIGR01851 64 eavslvdn......pntkildastayrtaedwvyGfpelaaeqrekianakrvanPGcyatg 119 ++v++vd+ ++k++dasta+rta++wvyGfpelaa q + +++a rv+nPGcyatg lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1253 64 DTVAMVDEierssgRKVKVIDASTAHRTADGWVYGFPELAASQTQAVRDATRVSNPGCYATG 125 ******863332224689******************************************** PP TIGR01851 120 aiallrPlveaGilPadfPvtinavsGysGGGkaliakyeeesaddskkaafiiyglalehk 181 aia+lrPlv+aG++Pad+P+++ +vsGysGGG+++i++ye + + a++ +y+l l+hk lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1253 126 AIAMLRPLVDAGLIPADYPLSLPSVSGYSGGGRTMIEAYE-----AGTAAPYEAYALGLSHK 182 ****************************************.....3345799********** PP TIGR01851 182 hlpemrkhsglaskPiftPavGdfaqGllveiplhlaeldskvsaedihkalaeyykG.... 239 h+pe+ +++gl+++P+f+PavG+f qG+lv++plhl l +++ a d+h+ala++y lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1253 183 HIPEILRYTGLTRRPVFIPAVGNFRQGMLVQLPLHLDLLPGAPKASDLHDALASHYSHtntp 244 ********************************************************743333 PP TIGR01851 240 ekfvkvaelddaellddtildaqglngtnrlelfvfgsddgerallvarldnlGkGasGaav 301 e++v v + d l a++l +tn+lel vf++++ ++a+++arldnlGkGasGaav lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1253 245 EQWVSVLPPTDDL-----KLAADTLTDTNKLELRVFANEQYRQAVVIARLDNLGKGASGAAV 301 8999999876655.....468999************************************** PP TIGR01851 302 qnlnialGl 310 qnl+++lG+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_1253 302 QNLQLMLGV 310 ********7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (310 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.31 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory