Align ATP phosphoribosyltransferase (EC 2.4.2.17) (characterized)
to candidate Ac3H11_4722 ATP phosphoribosyltransferase (EC 2.4.2.17)
Query= reanno::BFirm:BPHYT_RS17715 (232 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4722 Length = 214 Score = 314 bits (804), Expect = 1e-90 Identities = 160/208 (76%), Positives = 179/208 (86%) Query: 17 LTLALSKGRIFEETLPLLAAAGIEVAEDPETSRKLILPTTDANLRVIIVRATDVPTYVEY 76 +TLALSKGRIF+ETLPLLAAAGIEV EDPE SRKLILPT N+RV++VRATDVPTYVEY Sbjct: 3 ITLALSKGRIFDETLPLLAAAGIEVLEDPEKSRKLILPTNQPNVRVVLVRATDVPTYVEY 62 Query: 77 GAADFGVAGKDVLLEHGGSGLYQPVDLDIARCRMSVAVAAGFDYANAVRQGARLRVATKY 136 G AD GV GKD L+EHGG GLYQP+DL IA+CR+SVAV FDY AV+QGARL+VATKY Sbjct: 63 GGADIGVTGKDTLIEHGGQGLYQPLDLQIAKCRVSVAVRNDFDYERAVKQGARLKVATKY 122 Query: 137 VETAREHFAAKGVHVDLIKLYGSMELAPLVGLADAIVDLVSSGNTLRANNLVEVEEIMQI 196 AR+ FA KGVHVD++KLYGSMELAPL GLADAIVDLVS+GNTL+AN+LVEVE IM I Sbjct: 123 TSIARDFFATKGVHVDMVKLYGSMELAPLTGLADAIVDLVSTGNTLKANHLVEVERIMDI 182 Query: 197 SSRLVVNQAALKLKRAALRPILDAFERA 224 SS LVVNQAALKLK+A LR I+DAF A Sbjct: 183 SSYLVVNQAALKLKQAPLRRIIDAFAGA 210 Lambda K H 0.318 0.132 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 214 Length adjustment: 22 Effective length of query: 210 Effective length of database: 192 Effective search space: 40320 Effective search space used: 40320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
Align candidate Ac3H11_4722 (ATP phosphoribosyltransferase (EC 2.4.2.17))
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.479.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-64 201.2 0.1 7.9e-64 201.0 0.1 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4722 ATP phosphoribosyltransferase (E Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4722 ATP phosphoribosyltransferase (EC 2.4.2.17) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 201.0 0.1 7.9e-64 7.9e-64 1 183 [] 3 188 .. 3 188 .. 0.95 Alignments for each domain: == domain 1 score: 201.0 bits; conditional E-value: 7.9e-64 TIGR00070 1 lriAlpKGrleeetlkllekaglklskke..erkliasaedeevevlllrakdiptyvekga 60 +++Al KGr+++etl ll++ag+++ + +rkli +++++v+v+l+ra+d+ptyve+g lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4722 3 ITLALSKGRIFDETLPLLAAAGIEVLEDPekSRKLILPTNQPNVRVVLVRATDVPTYVEYGG 64 799*********************87765589****************************** PP TIGR00070 61 adlGitGkDlleEsead.vvelldlgfgkcklvlAvpeesdvesledlkegk..riATkypn 119 ad+G+tGkD+l E++ + +++ ldl++ kc++++Av+++ d+e+ ++k+g+ ++ATky++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4722 65 ADIGVTGKDTLIEHGGQgLYQPLDLQIAKCRVSVAVRNDFDYER--AVKQGArlKVATKYTS 124 *************88777************************99..45544446******** PP TIGR00070 120 ltreylekkgvkveivkleGavElapllgladaIvDivetGttLrengLkiieeilessarl 181 ++r+++++kgv+v++vkl+G++Elapl+gladaIvD+v+tG+tL++n+L+++e+i+++s++l lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4722 125 IARDFFATKGVHVDMVKLYGSMELAPLTGLADAIVDLVSTGNTLKANHLVEVERIMDISSYL 186 *************************************************************9 PP TIGR00070 182 ia 183 ++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4722 187 VV 188 85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (214 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.45 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory