Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate Ac3H11_2295 N-succinyl-L,L-diaminopimelate aminotransferase alternative (EC 2.6.1.17)
Query= BRENDA::Q9ZEX3 (397 letters) >lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 N-succinyl-L,L-diaminopimelate aminotransferase alternative (EC 2.6.1.17) Length = 401 Score = 466 bits (1198), Expect = e-136 Identities = 241/401 (60%), Positives = 292/401 (72%), Gaps = 9/401 (2%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 MNP L L PYPFE+LR L A P PI+L +GEP+H P + A++ NL GL+ Sbjct: 1 MNPLLSHLQPYPFERLRQLFAGVTPPAA-YSPISLGMGEPRHPTPQFIKDALSNNLEGLA 59 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIPAPDPESEVLPVLGSREALFAFAQTVIDPSAGA-L 119 YP+T GEP LR+A ++WL++RY++ DP ++VLPV GSREALFAFAQT+IDPS G L Sbjct: 60 SYPATAGEPRLREAFTRWLNQRYALTL-DPGTQVLPVNGSREALFAFAQTIIDPSKGQPL 118 Query: 120 VVCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNPA 179 VVCPNPFYQIYEGAALLAGA PYY +DPAR+F + VP+ VW RTQL+FVCSPGNP Sbjct: 119 VVCPNPFYQIYEGAALLAGAQPYYAPSDPARNFAVNWDTVPESVWERTQLLFVCSPGNPT 178 Query: 180 GNVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYTNLVA 239 G VM L EW+ LF LSDR+GFVIA+ ECYSEIY D PPLG LQAA +LGR + NL++ Sbjct: 179 GAVMPLCEWQKLFALSDRYGFVIASDECYSEIYF-RDEPPLGGLQAAEKLGRRDFKNLIS 237 Query: 240 FSSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAW-SMRRMCRK 298 F+SLSKRSNVPG+RSGFVAGDAAL+ FLLYRTYHGSAMSP+V AASIAAW + + Sbjct: 238 FTSLSKRSNVPGLRSGFVAGDAALIKSFLLYRTYHGSAMSPIVQAASIAAWGDEQHVVEN 297 Query: 299 TAQYRAKFEAVLPILQNVLDVRAPQASFYLWAGTPG----SDTAFARELYGRTGVTVLPG 354 +YR KF V P+L V++V P A FYLWA P +D FAR L + VTVLPG Sbjct: 298 RTRYRKKFAQVTPLLAGVMEVALPDAGFYLWAKVPDALGMTDAEFARALLAQYNVTVLPG 357 Query: 355 SLLAREAHNANPGQGRIRIALVAPLDQCVQAAERIAHFART 395 S LAREA +NPG R+R+ALVA ++CV+AA RI F ++ Sbjct: 358 SYLAREAQGSNPGAQRVRMALVAETEECVEAALRIVQFIQS 398 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 586 Number of extensions: 26 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 401 Length adjustment: 31 Effective length of query: 366 Effective length of database: 370 Effective search space: 135420 Effective search space used: 135420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate Ac3H11_2295 (N-succinyl-L,L-diaminopimelate aminotransferase alternative (EC 2.6.1.17))
to HMM TIGR03538 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03538.hmm # target sequence database: /tmp/gapView.8583.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03538 [M=395] Accession: TIGR03538 Description: DapC_gpp: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-190 618.6 0.0 2.4e-190 618.4 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 N-succinyl-L,L-diaminopimelate a Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 N-succinyl-L,L-diaminopimelate aminotransferase alternative (EC 2.6. # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 618.4 0.0 2.4e-190 2.4e-190 1 395 [] 1 396 [. 1 396 [. 0.98 Alignments for each domain: == domain 1 score: 618.4 bits; conditional E-value: 2.4e-190 TIGR03538 1 mnpnlerlkpyPfeklaellkdvtppadleeialsiGePkhatPafvlealvenleelskyP 62 mnp l++l+pyPfe+l++l+++vtppa +++i+l +GeP+h+tP+f+++al +nle+l++yP lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 1 MNPLLSHLQPYPFERLRQLFAGVTPPAAYSPISLGMGEPRHPTPQFIKDALSNNLEGLASYP 62 9************************************************************* PP TIGR03538 63 ttkGlpelreaiaeWlerrfelpagvdperqvlPvnGtrealfafvqavidrae.kalvvlP 123 +t+G+p+lrea ++Wl++r++l+ dp +qvlPvnG+realfaf+q++id+++ ++lvv+P lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 63 ATAGEPRLREAFTRWLNQRYALTL--DPGTQVLPVNGSREALFAFAQTIIDPSKgQPLVVCP 122 *********************987..*************************9988******* PP TIGR03538 124 nPfyqiyeGaallagaepyflnctaengfkpdfdavpeevWkrvqllfvcsPgnPtGavlsl 185 nPfyqiyeGaallaga+py+ +++++ +f ++d+vpe+vW+r+qllfvcsPgnPtGav++l lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 123 NPFYQIYEGAALLAGAQPYYAPSDPARNFAVNWDTVPESVWERTQLLFVCSPGNPTGAVMPL 184 ************************************************************** PP TIGR03538 186 eelkklleladkydfiiasdecyselyldeaeaPvGlleaaaelGrddfkrllvfhslskrs 247 e++kl++l+d+y+f+iasdecyse+y+ +e+P+G l+aa +lGr+dfk+l+ f+slskrs lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 185 CEWQKLFALSDRYGFVIASDECYSEIYF-RDEPPLGGLQAAEKLGRRDFKNLISFTSLSKRS 245 ****************************.556****************************** PP TIGR03538 248 nvPGlrsGfvaGdaellkeflryrtyhGcampiavqlasiaaWedekhvrenralyrekfaa 309 nvPGlrsGfvaGda+l+k+fl yrtyhG+am++ vq+asiaaW de+hv enr++yr+kfa+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 246 NVPGLRSGFVAGDAALIKSFLLYRTYHGSAMSPIVQAASIAAWGDEQHVVENRTRYRKKFAQ 307 ************************************************************** PP TIGR03538 310 vleilgavldlelPdasfylWlkvpd...gddeafaralyeeenvkvlpGrylsreaegvnP 368 v+ +l+ v+++ lPda+fylW+kvpd d++faral ++ nv+vlpG+yl+rea+g+nP lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 308 VTPLLAGVMEVALPDAGFYLWAKVPDalgMTDAEFARALLAQYNVTVLPGSYLAREAQGSNP 369 ************************8633368******************************* PP TIGR03538 369 Gegrvrlalvaeleecveaaerikkll 395 G++rvr+alvae+eecveaa ri +++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 370 GAQRVRMALVAETEECVEAALRIVQFI 396 ************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (395 nodes) Target sequences: 1 (401 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.13 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory