Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate Ac3H11_2295 N-succinyl-L,L-diaminopimelate aminotransferase alternative (EC 2.6.1.17)
Query= metacyc::MONOMER-6501 (397 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2295 Length = 401 Score = 466 bits (1198), Expect = e-136 Identities = 241/401 (60%), Positives = 292/401 (72%), Gaps = 9/401 (2%) Query: 1 MNPRLDALHPYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLS 60 MNP L L PYPFE+LR L A P PI+L +GEP+H P + A++ NL GL+ Sbjct: 1 MNPLLSHLQPYPFERLRQLFAGVTPPAA-YSPISLGMGEPRHPTPQFIKDALSNNLEGLA 59 Query: 61 VYPSTKGEPALRQAISQWLSRRYSIPAPDPESEVLPVLGSREALFAFAQTVIDPSAGA-L 119 YP+T GEP LR+A ++WL++RY++ DP ++VLPV GSREALFAFAQT+IDPS G L Sbjct: 60 SYPATAGEPRLREAFTRWLNQRYALTL-DPGTQVLPVNGSREALFAFAQTIIDPSKGQPL 118 Query: 120 VVCPNPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNPA 179 VVCPNPFYQIYEGAALLAGA PYY +DPAR+F + VP+ VW RTQL+FVCSPGNP Sbjct: 119 VVCPNPFYQIYEGAALLAGAQPYYAPSDPARNFAVNWDTVPESVWERTQLLFVCSPGNPT 178 Query: 180 GNVMSLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYTNLVA 239 G VM L EW+ LF LSDR+GFVIA+ ECYSEIY D PPLG LQAA +LGR + NL++ Sbjct: 179 GAVMPLCEWQKLFALSDRYGFVIASDECYSEIYF-RDEPPLGGLQAAEKLGRRDFKNLIS 237 Query: 240 FSSLSKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAW-SMRRMCRK 298 F+SLSKRSNVPG+RSGFVAGDAAL+ FLLYRTYHGSAMSP+V AASIAAW + + Sbjct: 238 FTSLSKRSNVPGLRSGFVAGDAALIKSFLLYRTYHGSAMSPIVQAASIAAWGDEQHVVEN 297 Query: 299 TAQYRAKFEAVLPILQNVLDVRAPQASFYLWAGTPG----SDTAFARELYGRTGVTVLPG 354 +YR KF V P+L V++V P A FYLWA P +D FAR L + VTVLPG Sbjct: 298 RTRYRKKFAQVTPLLAGVMEVALPDAGFYLWAKVPDALGMTDAEFARALLAQYNVTVLPG 357 Query: 355 SLLAREAHNANPGQGRIRIALVAPLDQCVQAAERIAHFART 395 S LAREA +NPG R+R+ALVA ++CV+AA RI F ++ Sbjct: 358 SYLAREAQGSNPGAQRVRMALVAETEECVEAALRIVQFIQS 398 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 586 Number of extensions: 26 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 401 Length adjustment: 31 Effective length of query: 366 Effective length of database: 370 Effective search space: 135420 Effective search space used: 135420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate Ac3H11_2295 (N-succinyl-L,L-diaminopimelate aminotransferase alternative (EC 2.6.1.17))
to HMM TIGR03538 (dapC: succinyldiaminopimelate transaminase (EC 2.6.1.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03538.hmm # target sequence database: /tmp/gapView.25404.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03538 [M=395] Accession: TIGR03538 Description: DapC_gpp: succinyldiaminopimelate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-190 618.6 0.0 2.4e-190 618.4 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 N-succinyl-L,L-diaminopimelate a Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 N-succinyl-L,L-diaminopimelate aminotransferase alternative (EC 2.6. # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 618.4 0.0 2.4e-190 2.4e-190 1 395 [] 1 396 [. 1 396 [. 0.98 Alignments for each domain: == domain 1 score: 618.4 bits; conditional E-value: 2.4e-190 TIGR03538 1 mnpnlerlkpyPfeklaellkdvtppadleeialsiGePkhatPafvlealvenleelskyP 62 mnp l++l+pyPfe+l++l+++vtppa +++i+l +GeP+h+tP+f+++al +nle+l++yP lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 1 MNPLLSHLQPYPFERLRQLFAGVTPPAAYSPISLGMGEPRHPTPQFIKDALSNNLEGLASYP 62 9************************************************************* PP TIGR03538 63 ttkGlpelreaiaeWlerrfelpagvdperqvlPvnGtrealfafvqavidrae.kalvvlP 123 +t+G+p+lrea ++Wl++r++l+ dp +qvlPvnG+realfaf+q++id+++ ++lvv+P lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 63 ATAGEPRLREAFTRWLNQRYALTL--DPGTQVLPVNGSREALFAFAQTIIDPSKgQPLVVCP 122 *********************987..*************************9988******* PP TIGR03538 124 nPfyqiyeGaallagaepyflnctaengfkpdfdavpeevWkrvqllfvcsPgnPtGavlsl 185 nPfyqiyeGaallaga+py+ +++++ +f ++d+vpe+vW+r+qllfvcsPgnPtGav++l lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 123 NPFYQIYEGAALLAGAQPYYAPSDPARNFAVNWDTVPESVWERTQLLFVCSPGNPTGAVMPL 184 ************************************************************** PP TIGR03538 186 eelkklleladkydfiiasdecyselyldeaeaPvGlleaaaelGrddfkrllvfhslskrs 247 e++kl++l+d+y+f+iasdecyse+y+ +e+P+G l+aa +lGr+dfk+l+ f+slskrs lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 185 CEWQKLFALSDRYGFVIASDECYSEIYF-RDEPPLGGLQAAEKLGRRDFKNLISFTSLSKRS 245 ****************************.556****************************** PP TIGR03538 248 nvPGlrsGfvaGdaellkeflryrtyhGcampiavqlasiaaWedekhvrenralyrekfaa 309 nvPGlrsGfvaGda+l+k+fl yrtyhG+am++ vq+asiaaW de+hv enr++yr+kfa+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 246 NVPGLRSGFVAGDAALIKSFLLYRTYHGSAMSPIVQAASIAAWGDEQHVVENRTRYRKKFAQ 307 ************************************************************** PP TIGR03538 310 vleilgavldlelPdasfylWlkvpd...gddeafaralyeeenvkvlpGrylsreaegvnP 368 v+ +l+ v+++ lPda+fylW+kvpd d++faral ++ nv+vlpG+yl+rea+g+nP lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 308 VTPLLAGVMEVALPDAGFYLWAKVPDalgMTDAEFARALLAQYNVTVLPGSYLAREAQGSNP 369 ************************8633368******************************* PP TIGR03538 369 Gegrvrlalvaeleecveaaerikkll 395 G++rvr+alvae+eecveaa ri +++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2295 370 GAQRVRMALVAETEECVEAALRIVQFI 396 ************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (395 nodes) Target sequences: 1 (401 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.56 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory