Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate Ac3H11_2298 N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)
Query= SwissProt::Q9JYL2 (381 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_2298 Length = 397 Score = 442 bits (1137), Expect = e-129 Identities = 226/394 (57%), Positives = 279/394 (70%), Gaps = 16/394 (4%) Query: 4 TQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDT----KNIWLRRG-- 57 +++L LA++LI+ PS+TPDD C LLA RL +GF E L G N+W +R Sbjct: 2 SRTLHLAEQLIALPSITPDDAGCLNLLAARLAPLGFECERLDSGPADFRVSNLWAKRPLP 61 Query: 58 ------TKAPVVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVT 111 V FAGHTDVVPTGP+ +W S PF P +DG+LYGRGA+DMKTSIA FV Sbjct: 62 RDQLAQAAIKTVVFAGHTDVVPTGPLAQWSSDPFVPTHKDGKLYGRGASDMKTSIAAFVV 121 Query: 112 ACERFVAKHPNHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKL 171 A E F+A P +A L+TSDEEG ++DGT VV+ LKAR E +DYCIVGEPT+V+K Sbjct: 122 AVEEFLAATPEPLVQLAFLLTSDEEGPSVDGTKVVVEQLKARGEPLDYCIVGEPTSVEKT 181 Query: 172 GDMIKNGRRGSLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPT 231 GDMIKNGRRG+LSG L+V+G QGHIAYP LA NP+H PAL EL VWD GN +FPPT Sbjct: 182 GDMIKNGRRGTLSGKLSVRGIQGHIAYPQLARNPIHQALPALAELAATVWDHGNAFFPPT 241 Query: 232 SFQISNINGGTGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCS 291 S+QISN++GGTGATNVIPGE+ + FNFRFSTEST GL+QRVHA+LD+HG++YDL+W+ Sbjct: 242 SWQISNMHGGTGATNVIPGEVVIDFNFRFSTESTAEGLQQRVHAMLDRHGLEYDLRWTLG 301 Query: 292 GQPFLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQ 351 GQPFLT G+L + AI I ELSTTGGTSDGRFI I ++IELGP NA+IH+ Sbjct: 302 GQPFLTTPGELVTAVQQAITAETSITTELSTTGGTSDGRFIAQICPQVIELGPPNASIHK 361 Query: 352 INENVRLNDIPKLSAVY----EGILARLLAGNAV 381 I+E+V + DI L +Y E + A+ LA AV Sbjct: 362 IDEHVVVADIEPLKNIYRRTLENLHAQALAATAV 395 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 397 Length adjustment: 30 Effective length of query: 351 Effective length of database: 367 Effective search space: 128817 Effective search space used: 128817 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate Ac3H11_2298 (N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18))
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.20759.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-155 501.6 0.0 7.3e-155 501.4 0.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2298 N-succinyl-L,L-diaminopimelate d Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2298 N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 501.4 0.0 7.3e-155 7.3e-155 2 370 .] 5 385 .. 4 385 .. 0.97 Alignments for each domain: == domain 1 score: 501.4 bits; conditional E-value: 7.3e-155 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefe....dtknlwatrgt...... 53 l+la++Li ++s+tP+dag+++l+a+rL lgfe+e+l + + nlwa+r lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2298 5 LHLAEQLIALPSITPDDAGCLNLLAARLAPLGFECERLDSGpadfRVSNLWAKRPLprdqla 66 689***********************************9984433478*****988888888 PP TIGR01246 54 ..eepvlvfaGhtDvvPaGelekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvk 113 +++vfaGhtDvvP+G+l +Wssdpf p+++dGklygrGa Dmk+s+aafvva+e+f++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2298 67 qaAIKTVVFAGHTDVVPTGPLAQWSSDPFVPTHKDGKLYGRGASDMKTSIAAFVVAVEEFLA 128 7666799******************************************************* PP TIGR01246 114 knadhkGslsllitsDeegeaidGtkkvvetlkerdelidyavvgePssvkklGDvikiGrr 175 + ++ +l++l+tsDeeg ++dGtk vve lk+r e +dy++vgeP+sv+k GD+ik+Grr lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2298 129 ATPEPLVQLAFLLTSDEEGPSVDGTKVVVEQLKARGEPLDYCIVGEPTSVEKTGDMIKNGRR 190 ************************************************************** PP TIGR01246 176 GsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffppsslqianieagt 237 G ++gkl+++GiqGh+aYP++a+nP+h+a+p+l+el+a+ +D+Gn+ffpp+s qi+n+++gt lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2298 191 GTLSGKLSVRGIQGHIAYPQLARNPIHQALPALAELAATVWDHGNAFFPPTSWQISNMHGGT 252 ************************************************************** PP TIGR01246 238 gasnviPgelkvkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklik 299 ga+nviPge+ + fn+rfs+e+++e l+++v+++ld+h+l+Y+l+w+l g+pflt g+l++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2298 253 GATNVIPGEVVIDFNFRFSTESTAEGLQQRVHAMLDRHGLEYDLRWTLGGQPFLTTPGELVT 314 ************************************************************** PP TIGR01246 300 kvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklse 361 +v++ai+ + +++elst+GGtsD+rfia++ +v+elG+ n++ihk++e+v ++d+e l++ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2298 315 AVQQAITAETSITTELSTTGGTSDGRFIAQICPQVIELGPPNASIHKIDEHVVVADIEPLKN 376 ************************************************************** PP TIGR01246 362 vyeklleel 370 +y+++le+l lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_2298 377 IYRRTLENL 385 ******997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (397 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.61 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory