Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate Ac3H11_1907 Acetylglutamate kinase (EC 2.7.2.8)
Query= curated2:A8AA51 (264 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_1907 Length = 317 Score = 101 bits (252), Expect = 2e-26 Identities = 75/224 (33%), Positives = 111/224 (49%), Gaps = 15/224 (6%) Query: 29 VFVHGGGDLVDEWERKMGMEPQFKVSASGIKFRYTDEKELEVFVAVLGGLLNKKIVASFA 88 V VHGGG ++ ++G + +F R TD + +EV VL G + + IV Sbjct: 85 VVVHGGGPQIETALNRLGKKGEFIQG-----MRVTDAETMEVVEWVLAGEVQQDIVGLIN 139 Query: 89 SYGRGAVGLTGADGPSVIAERKKKVIVQEKVGERLVKRAIAGGYTGKIKEVKTDLIKALV 148 G AVGLTG DG + A++ K V + E V G G I + ++KAL Sbjct: 140 QAGGKAVGLTGRDGGMIRAQKLKMVDNKNPAIEHDV------GQVGDIVSIDPSVVKALQ 193 Query: 149 ERGLVPVVAPIALSPEGELLNVNGDQMAAELAKALSAEYLVLLTDVPGVL-MDGKVVPEI 207 + +PV++PI E N+N D +A++LA+ L AE L+LLT+ PGVL G ++ ++ Sbjct: 194 DDAFIPVISPIGFGENNESYNINADVVASKLAEVLKAEKLMLLTNTPGVLDKAGNLLTDL 253 Query: 208 KSSEAEEVAK--KVGPGMNIKIIMAGRVASGGTKVV-ICDGTVP 248 + +E+ + GM KI A A G V I DG VP Sbjct: 254 TARRIDELFADGTISGGMLPKIAGALDAAKAGVNAVHIIDGRVP 297 Lambda K H 0.316 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 317 Length adjustment: 26 Effective length of query: 238 Effective length of database: 291 Effective search space: 69258 Effective search space used: 69258 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory