Align O-succinylhomoserine sulfhydrylase; OSH sulfhydrylase; OSHS sulfhydrylase; EC 2.5.1.- (characterized)
to candidate Ac3H11_34 Methionine gamma-lyase (EC 4.4.1.11)
Query= SwissProt::P9WGB5 (406 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_34 Length = 434 Score = 263 bits (672), Expect = 7e-75 Identities = 152/368 (41%), Positives = 220/368 (59%), Gaps = 6/368 (1%) Query: 40 MYLTSGYVYGSAAVAEKSFAGELDHYVYSRYGNPTVSVFEERLRLIEGAPAAFATASGMA 99 ++ ++ Y + A + FAG+ Y Y+R NPT+++ E RL +E A SGM Sbjct: 35 IHTSATYAFPDVAYGARCFAGQEPGYFYTRIANPTLALLEGRLAALEEGAGAVVFGSGMG 94 Query: 100 AVFTSLGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVQTVFVDGDDLSQWERALSVPT 159 A+ +L ++L GD ++A +L+G F L R+GV VD D ++ AL+ T Sbjct: 95 AITATLWSMLEPGDEILADLTLYGCTFSFLHHGLGRFGVTVRHVDMTDPARVAEALTAKT 154 Query: 160 QAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFATPLLQQGFPLGVDVVVYSGTK 219 + ++ ETP+NP LVDIAAV+ LAHA GAKVV+DN + TP LQQ LG DV V+S TK Sbjct: 155 RVLYLETPANPNMRLVDIAAVSALAHAQGAKVVVDNTYCTPYLQQPLLLGADVSVHSMTK 214 Query: 220 HIDGQGRV-LGGAILGDREYIDG-PVQKLMRHTGPAMSAFNAWVLLKGLETLAIRVQHSN 277 ++ G G + G A+ D E + L TG MSA +A ++++GL+TLA+R+ Sbjct: 215 YLGGHGDLTAGAAVFADAELAQRVRLYGLKDMTGAVMSAQDAHLVMRGLKTLALRMDRHC 274 Query: 278 ASAQRIAEFLNGHPSVRWVRYPYLPSHPQYDLAKRQMSGGGTVVTFALDCPEDVAKQRAF 337 SAQ++AEF+ HP+ V YP LPS Q+ LAK+QM G ++ F L Q Sbjct: 275 QSAQKVAEFIAAHPAAAAVHYPGLPSFAQHALAKQQMRQMGGMIAFEL----RGGLQAGV 330 Query: 338 EVLDKMRLIDISNNLGDAKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEDTDDL 397 +D ++L+ + +LGDA++L HPA+ TH PE RAA G+ +G+VR+SVGLED DDL Sbjct: 331 RFMDALQLVTRAVSLGDAETLAQHPASMTHSTYTPEQRAAHGIAEGLVRLSVGLEDLDDL 390 Query: 398 IADIDRAL 405 +ADI +AL Sbjct: 391 LADIGQAL 398 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 434 Length adjustment: 32 Effective length of query: 374 Effective length of database: 402 Effective search space: 150348 Effective search space used: 150348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory