Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate Ac3H11_4342 Omega-amino acid--pyruvate aminotransferase (EC 2.6.1.18)
Query= curated2:O27392 (390 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4342 Length = 454 Score = 171 bits (432), Expect = 5e-47 Identities = 128/422 (30%), Positives = 195/422 (46%), Gaps = 51/422 (12%) Query: 16 QTYTRQPIVLSHGKGATVWDIEGNSYIDCFAGVAVNSIGHAHPKVALAICHQAQRLIHSS 75 + + +P ++ G+GA D +G D +G+ + +GH VA AI A L +S Sbjct: 34 RNFKAKPRMIVSGQGAYYTDADGRKIFDGLSGLWCSGLGHGRKDVAEAIGKAAATLDYSP 93 Query: 76 NIYYTRE-QVELAKLLTAISPH--DRVFFANSGAEANEGAIKLARKF------TGKSEII 126 + LA L ++P D VFF SG+E+ + ++K+AR + K+ +I Sbjct: 94 AFQFGHPASFALANKLKELTPAGLDYVFFTGSGSESADTSLKMARAYWRAKGQASKTRLI 153 Query: 127 AAENSFHGRTLATVTATG----QKKYSE-------PFRPLPEGFKHVPYGDIG--AMADA 173 E +HG ++ G +K + + P P G + G A+AD Sbjct: 154 GREKGYHGVNYGGISVGGIVGNRKTFGQGIEADHLPHTQPPAGTFQKGMAEDGGRALADK 213 Query: 174 VGD--------ETAAIILEPVQGEGGVIIPPEGYLKDVQELARQNDVLLILDEVQTGFGR 225 + D AA+I+EP G GV+IPP+GYL+ ++E+ QN++LLI DEV TGFGR Sbjct: 214 LLDVIALHDASNIAAVIVEPFSGSAGVVIPPKGYLERIREICTQNNILLIFDEVITGFGR 273 Query: 226 TGAMFASQLFGVEPDITTVAKAM-GGGYPIGAVLANERVAMAF--EPG-------DHGST 275 GA ++ FGV PDI AK + G P+G V+A + + F + G HG T Sbjct: 274 CGAWTGAEAFGVTPDILNFAKQVTNGAQPLGGVIATKEIYDTFISQGGPEYMLEFPHGYT 333 Query: 276 FGGNPWGCAAAIATIEVLMDEKLPERAAKMGSYFLGRLRQVLHGCDAVRDIRGVGLMIGI 335 + +P CAA A +++L E +P R + +F + L G V DIR GL GI Sbjct: 334 YSAHPVACAAGNAVLDILQKEDMPGRVKALAPHFENAVHG-LKGAKHVADIRNYGLAAGI 392 Query: 336 EIDGECAGVVDAAREMGVLINC--------TAGKVIRIVPPLVIKKEEIDAAVDVLGHVI 387 I A R + + C G I++ PP + EID V LG + Sbjct: 393 TI--SALPSEPAKRPYEIAMKCWEKGFYVRYGGDTIQLAPPFISTSAEIDRMVSALGDAL 450 Query: 388 SD 389 + Sbjct: 451 HE 452 Lambda K H 0.320 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 454 Length adjustment: 32 Effective length of query: 358 Effective length of database: 422 Effective search space: 151076 Effective search space used: 151076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory