Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate Ac3H11_4771 Glutamate 5-kinase (EC 2.7.2.11)
Query= BRENDA::P0A7B5 (367 letters) >FitnessBrowser__acidovorax_3H11:Ac3H11_4771 Length = 384 Score = 280 bits (715), Expect = 6e-80 Identities = 163/370 (44%), Positives = 223/370 (60%), Gaps = 5/370 (1%) Query: 1 MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQL----HAAGHRIVIVTSGAIAAG 56 + D++ +VVK+G+S++T R L+ I E RQ A L +V+V+SGAIA G Sbjct: 10 LRDARRIVVKVGSSLVTNEGRGLDETAIGEWSRQLAALVRGDGGVAREVVMVSSGAIAEG 69 Query: 57 REHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLN 116 + LG+ P I Q AAVGQ L Q++E G+ Q+LLT AD+ DRER+LN Sbjct: 70 MKRLGWTTRPQEIHELQAAAAVGQMGLAQMYETKLREEGMGSAQVLLTHADLADRERYLN 129 Query: 117 ARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYT 176 AR TL LL +VPVINEND V EIK GDND L AL A L AD L++LTDQKGLYT Sbjct: 130 ARSTLLTLLRLGVVPVINENDTVVNDEIKFGDNDTLGALVANLVEADALIILTDQKGLYT 189 Query: 177 ADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAG 236 ADPR +P A+ + + D AL A+AG + S +G GGM TK+ AA A +G T+IA G Sbjct: 190 ADPRRDPAAQFVHEAKAGDLALEAMAGGAGSSIGRGGMITKILAAKRAAGSGASTVIAWG 249 Query: 237 SKPGVIGDVMEGISVGTLFHAQATPLENRKRWIFG-APPAGEITVDEGATAAILERGSSL 295 +P V+ ++ G S+GTL AQ + RK+W+ G + VD GA A + + G SL Sbjct: 250 REPDVLLRLVGGESLGTLLVAQTQKKQARKQWMADHLQLRGSVVVDAGAAAKVRDEGKSL 309 Query: 296 LPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYG 355 LP G+ +V G+FSRG+VI + + G +IA G++ Y + R + S E + +LGY Sbjct: 310 LPIGMTAVEGDFSRGDVIAVRDASGVEIARGLANYAAAEARLLCRKPSAEFEKLLGYVAE 369 Query: 356 PVAVHRDDMI 365 P VHRD+++ Sbjct: 370 PEMVHRDNLV 379 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 384 Length adjustment: 30 Effective length of query: 337 Effective length of database: 354 Effective search space: 119298 Effective search space used: 119298 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate Ac3H11_4771 (Glutamate 5-kinase (EC 2.7.2.11))
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.29090.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-126 406.8 2.0 5.2e-126 406.6 2.0 1.0 1 lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4771 Glutamate 5-kinase (EC 2.7.2.11) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4771 Glutamate 5-kinase (EC 2.7.2.11) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 406.6 2.0 5.2e-126 5.2e-126 1 362 [. 14 379 .. 14 380 .. 0.98 Alignments for each domain: == domain 1 score: 406.6 bits; conditional E-value: 5.2e-126 TIGR01027 1 kriVvKlGsssLteesgklkrsklaelveqvaklkk.aG...hevvivsSGavaaGleaLgl 58 +riVvK+Gss++t+e + l+++ + e +q+a+l + +G +evv+vsSGa+a G+++Lg lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4771 14 RRIVVKVGSSLVTNEGRGLDETAIGEWSRQLAALVRgDGgvaREVVMVSSGAIAEGMKRLGW 75 59*************999***************97633334489****************** PP TIGR01027 59 perpkklaekQalaaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleel 120 ++rp++++e Qa+aaVGQ L + ye+++ + g+ +aQ+LLt+adl++rerylNar+tl +l lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4771 76 TTRPQEIHELQAAAAVGQMGLAQMYETKLREEGMGSAQVLLTHADLADRERYLNARSTLLTL 137 ************************************************************** PP TIGR01027 121 lelgvvpivNENDtvaveeikfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAk 182 l lgvvp++NENDtv +eikfGDNDtL alva+lveAd+L++ltd++gLy+adpr++p A+ lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4771 138 LRLGVVPVINENDTVVNDEIKFGDNDTLGALVANLVEADALIILTDQKGLYTADPRRDPAAQ 199 ************************************************************** PP TIGR01027 183 lieeveeieeelkavagssgssvGTGGmrtKleaaelAsragveviiasgekpekiadlled 244 +++e ++ + +l+a+ag++gss+G GGm tK+ aa+ A+ +g ++ia g++p+ +++l+ + lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4771 200 FVHEAKAGDLALEAMAGGAGSSIGRGGMITKILAAKRAAGSGASTVIAWGREPDVLLRLVGG 261 ************************************************************** PP TIGR01027 245 aavgtlfeakkkklknrkqwilaaseakGkiivdegaeeallekgksLlpagvvevegnFsr 306 +++gtl+ a+++k ++rkqw++ +++ +G+++vd+ga+++++++gksLlp g+++veg+Fsr lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4771 262 ESLGTLLVAQTQKKQARKQWMADHLQLRGSVVVDAGAAAKVRDEGKSLLPIGMTAVEGDFSR 323 ************************************************************** PP TIGR01027 307 gevveilaeegqeigkglvnysseelekikglkseeiedvLgyekkeevvhrdnlv 362 g+v+ +++ +g ei++gl+ny ++e + +++++s+e e++Lgy + e vhrdnlv lcl|FitnessBrowser__acidovorax_3H11:Ac3H11_4771 324 GDVIAVRDASGVEIARGLANYAAAEARLLCRKPSAEFEKLLGYVAEPEMVHRDNLV 379 ******************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (384 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.77 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory