Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate AZOBR_RS00785 AZOBR_RS00785 argininosuccinate synthase
Query= SwissProt::P59846 (400 letters) >FitnessBrowser__azobra:AZOBR_RS00785 Length = 411 Score = 513 bits (1322), Expect = e-150 Identities = 256/395 (64%), Positives = 305/395 (77%), Gaps = 4/395 (1%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIAL-- 59 K+VLAYSGGLDTS+ILKWL+ETY+ EV+ FTAD+GQGEE+E AR+KA G Sbjct: 11 KVVLAYSGGLDTSVILKWLQETYQCEVVTFTADLGQGEELEPARKKAELLGIKPENIFID 70 Query: 60 DLKEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKG 119 DL+EEFVRDFVFPM RA +YEG YLLGTSIARPLIAK + IA + GA+A+AHGATGKG Sbjct: 71 DLREEFVRDFVFPMFRANTLYEGTYLLGTSIARPLIAKRQIEIANQVGADAVAHGATGKG 130 Query: 120 NDQVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQ--EKPYSMDAN 177 NDQVRFEL YAL+PDIK+IAPWREW R +I YAE + IP+ + E PYS DAN Sbjct: 131 NDQVRFELGYYALRPDIKIIAPWREWDLSSRTRLIDYAEKNQIPIAKDKRGEAPYSTDAN 190 Query: 178 LLHISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAA 237 LLHISYEG LEDPW EP + M+ + PE+APD P YVEVEF GD VA++G+ LSPAA Sbjct: 191 LLHISYEGKALEDPWVEPFEDMYTRSVAPEKAPDTPTYVEVEFKRGDAVAIDGKALSPAA 250 Query: 238 LLQRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQ 297 LL LN +GG +G+GR+D+VENR+VGMKSRGVYETPGGTIL A RA+ES+TLDR H Sbjct: 251 LLTELNRLGGENGIGRLDLVENRYVGMKSRGVYETPGGTILLAAHRAMESITLDRGAGHL 310 Query: 298 RDMLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSL 357 +D L P+YAEL+Y G+W++PER ALQA D V GV RLKL+KGNV VVGRK+P SL Sbjct: 311 KDELMPRYAELIYCGYWFSPERLALQALIDQTQEPVNGVVRLKLFKGNVTVVGRKSPNSL 370 Query: 358 YRQDLVSFDEAGGYDQKDAEGFIKIQALRLRVRAL 392 YR D V+F+E Y+QKDAEGFIK+ ALRLR+ A+ Sbjct: 371 YRMDYVTFEEDSVYNQKDAEGFIKLNALRLRLGAM 405 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 411 Length adjustment: 31 Effective length of query: 369 Effective length of database: 380 Effective search space: 140220 Effective search space used: 140220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate AZOBR_RS00785 AZOBR_RS00785 (argininosuccinate synthase)
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.16586.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-145 471.9 0.0 1.2e-145 471.7 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS00785 AZOBR_RS00785 argininosuccinate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS00785 AZOBR_RS00785 argininosuccinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 471.7 0.0 1.2e-145 1.2e-145 1 387 [. 11 401 .. 11 407 .. 0.97 Alignments for each domain: == domain 1 score: 471.7 bits; conditional E-value: 1.2e-145 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGae..kayviDareefvk 66 kvvlaysGGlDtsv+lk+l+e +ev+++t+d+Gq+ e+l+ +++ka lG + + + D reefv+ lcl|FitnessBrowser__azobra:AZOBR_RS00785 11 KVVLAYSGGLDTSVILKWLQETyQCEVVTFTADLGQG-EELEPARKKAELLGIKpeNIFIDDLREEFVR 78 8*********************899***********9.9************986214555589****** PP TIGR00032 67 dylfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdl 135 d++f+ +an++yeg+Yll+t++aRpliak+++e+a++ ga+avahG+tgKGnDqvRFel ++l+pd+ lcl|FitnessBrowser__azobra:AZOBR_RS00785 79 DFVFPMFRANTLYEGTYLLGTSIARPLIAKRQIEIANQVGADAVAHGATGKGNDQVRFELGYYALRPDI 147 ********************************************************************* PP TIGR00032 136 kviaPvreleli.ReeeieyaaekGievpvek..ekaysiDenllgrsiEageLEdpsteppediyelv 201 k+iaP+re++l+ R+ +i+ya+++ i+++ +k e +ys+D nll++s+E++ LEdp++ep ed+y+ lcl|FitnessBrowser__azobra:AZOBR_RS00785 148 KIIAPWREWDLSsRTRLIDYAEKNQIPIAKDKrgEAPYSTDANLLHISYEGKALEDPWVEPFEDMYTRS 216 ***********99***************99875579********************************9 PP TIGR00032 202 kdpiektedepevveieFekGvPvalngeslepvelilkaneiagkhGvGriDivEdRiiglKsReiYE 270 + p++++ d+p +ve+eF++G va++g+ l+p l+ ++n+++g++G+Gr+D vE+R++g+KsR++YE lcl|FitnessBrowser__azobra:AZOBR_RS00785 217 VAPEKAP-DTPTYVEVEFKRGDAVAIDGKALSPAALLTELNRLGGENGIGRLDLVENRYVGMKSRGVYE 284 9777776.************************************************************* PP TIGR00032 271 apalllLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdplaealdalikktqervtGtvrvk 339 +p+ ++L+ Ah+++e+ +l++ ++k+ +y+eliY G+wf+p++ al+ali++tqe v+G+vr+k lcl|FitnessBrowser__azobra:AZOBR_RS00785 285 TPGGTILLAAHRAMESITLDRGAGHLKDELMPRYAELIYCGYWFSPERLALQALIDQTQEPVNGVVRLK 353 ********************************************************************* PP TIGR00032 340 lfkGnaivigrkseyslYdeelvsfekdkefdqkdaiGfikirglqik 387 lfkGn++v+grks++slY + v+fe+d+ ++qkda+Gfik+++l+ + lcl|FitnessBrowser__azobra:AZOBR_RS00785 354 LFKGNVTVVGRKSPNSLYRMDYVTFEEDSVYNQKDAEGFIKLNALRLR 401 ********************************************9976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (411 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.76 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory