Align 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate AZOBR_RS12025 AZOBR_RS12025 3-dehydroquinate dehydratase
Query= BRENDA::W6JLW3 (160 letters) >FitnessBrowser__azobra:AZOBR_RS12025 Length = 149 Score = 182 bits (461), Expect = 3e-51 Identities = 84/141 (59%), Positives = 110/141 (78%) Query: 17 ITVLNGPNLNMLGLRQPGIYGHATLDDVEQVCIQAAERLDVAIDFRQTNGEGELVSWVQE 76 + VLNGPNLNMLG+R+P IYG TLDD+E C + AE+L +AIDFRQ+N EGELVSW+Q+ Sbjct: 7 VLVLNGPNLNMLGVREPHIYGSMTLDDLEGACQERAEQLGLAIDFRQSNHEGELVSWIQQ 66 Query: 77 CRGRADGIVINPAAYGHTSIALLDALLAVELPVVEVHISNIHRREPFRHHTYVSQAAIGV 136 R DGIVIN AY HTS+A++DAL+ ELP+VEVH+SNI++RE RHH+++S A G+ Sbjct: 67 ARTEHDGIVINAGAYSHTSVAIMDALILSELPIVEVHLSNIYKREAIRHHSHISAVAKGM 126 Query: 137 ICGLGVRGYAHALQAITDMIE 157 ICG G GY AL A+ +++E Sbjct: 127 ICGFGPHGYLLALDAMANILE 147 Lambda K H 0.322 0.139 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 100 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 160 Length of database: 149 Length adjustment: 17 Effective length of query: 143 Effective length of database: 132 Effective search space: 18876 Effective search space used: 18876 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
Align candidate AZOBR_RS12025 AZOBR_RS12025 (3-dehydroquinate dehydratase)
to HMM TIGR01088 (aroQ: 3-dehydroquinate dehydratase, type II (EC 4.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01088.hmm # target sequence database: /tmp/gapView.3502.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01088 [M=141] Accession: TIGR01088 Description: aroQ: 3-dehydroquinate dehydratase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-65 202.8 0.2 1e-64 202.6 0.2 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS12025 AZOBR_RS12025 3-dehydroquinate d Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS12025 AZOBR_RS12025 3-dehydroquinate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 202.6 0.2 1e-64 1e-64 2 140 .. 7 145 .. 6 146 .. 0.99 Alignments for each domain: == domain 1 score: 202.6 bits; conditional E-value: 1e-64 TIGR01088 2 ilvlnGPnlnlLGkrepkvyGsltleeieelleeaakelevevevfqsnsegelidkihealeqvdgiv 70 +lvlnGPnln+LG rep++yGs+tl+++e ++e a++l++ ++++qsn+egel+ +i++a + dgiv lcl|FitnessBrowser__azobra:AZOBR_RS12025 7 VLVLNGPNLNMLGVREPHIYGSMTLDDLEGACQERAEQLGLAIDFRQSNHEGELVSWIQQARTEHDGIV 75 89******************************************************************* PP TIGR01088 71 inpaalthtsvalrDalaavslPvvevhlsnvhareefrkksvlaevakGvivGlGakgyklalealve 139 in++a++htsva+ Dal +lP+vevhlsn+++re r++s++++vakG+i+G+G++gy lal a+++ lcl|FitnessBrowser__azobra:AZOBR_RS12025 76 INAGAYSHTSVAIMDALILSELPIVEVHLSNIYKREAIRHHSHISAVAKGMICGFGPHGYLLALDAMAN 144 ******************************************************************998 PP TIGR01088 140 a 140 + lcl|FitnessBrowser__azobra:AZOBR_RS12025 145 I 145 7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (141 nodes) Target sequences: 1 (149 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 5.15 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory