Align Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 (characterized)
to candidate AZOBR_RS31185 AZOBR_RS31185 ribose-phosphate pyrophosphokinase
Query= SwissProt::P0A1V6 (315 letters) >FitnessBrowser__azobra:AZOBR_RS31185 Length = 311 Score = 323 bits (828), Expect = 3e-93 Identities = 167/312 (53%), Positives = 228/312 (73%), Gaps = 4/312 (1%) Query: 4 MKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAPT 63 MK+ AGN+ LA+ I+ L L A++ RFSD EV V+I ENVRG D+F++QST P Sbjct: 1 MKVLAGNSNRPLAEAISTCLGVPLTKASIRRFSDMEVFVEILENVRGEDVFVVQSTSFPA 60 Query: 64 NDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGVD 123 NDNLMEL+V +DALRR SA RITAV+PY+GYARQDR+ R PI+AK+VA+ ++ G + Sbjct: 61 NDNLMELLVTIDALRRGSARRITAVLPYYGYARQDRKT-GPRTPISAKLVANLITQAGAN 119 Query: 124 RVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQL--NLDNPIVVSPDIGGVVRARAIA 181 RVLT+DLHA QIQGFFD+P DN+ +P+ +D+ ++ +VSPD+GGVVRAR++A Sbjct: 120 RVLTMDLHAGQIQGFFDIPTDNLMAAPVFEKDIRATFEDIGEVTMVSPDVGGVVRARSLA 179 Query: 182 KLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGA 241 K L D D+AIIDKRR RA VS+VM+IIGDV R C+L+DD++D+GGTLC AA AL + GA Sbjct: 180 KRL-DADLAIIDKRRERAGVSEVMNIIGDVKNRRCILLDDIVDSGGTLCNAAVALMDAGA 238 Query: 242 KRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLTDEIKALPNVRTLTLSGMLAEAIR 301 K V AY TH + SG A + S ++++V D+I T+ ++ N+R LT++ +LA+AI Sbjct: 239 KSVHAYCTHGVLSGGAVARVAVSPLEQLVTTDSIQATEAVRVSRNIRQLTIAPLLADAIT 298 Query: 302 RISNEESISAMF 313 RIS E S+S++F Sbjct: 299 RISEERSVSSLF 310 Lambda K H 0.322 0.137 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 311 Length adjustment: 27 Effective length of query: 288 Effective length of database: 284 Effective search space: 81792 Effective search space used: 81792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate AZOBR_RS31185 AZOBR_RS31185 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.8863.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-116 374.9 0.3 1.3e-116 374.8 0.3 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS31185 AZOBR_RS31185 ribose-phosphate p Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS31185 AZOBR_RS31185 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 374.8 0.3 1.3e-116 1.3e-116 1 309 [] 1 311 [] 1 311 [] 0.98 Alignments for each domain: == domain 1 score: 374.8 bits; conditional E-value: 1.3e-116 TIGR01251 1 lkilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmell 69 +k+l+g+s++ lae+++ lg++l+++++++F+d E+ v+i e+vrg+dvf++ qsts p nd+lmell lcl|FitnessBrowser__azobra:AZOBR_RS31185 1 MKVLAGNSNRPLAEAISTCLGVPLTKASIRRFSDMEVFVEILENVRGEDVFVV-QSTSFPANDNLMELL 68 799**************************************************.*************** PP TIGR01251 70 llidalkrasaksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseqiqgfFdv 138 ++idal+r sa+++tav+PyygYaRqd+k+ +r+pisaklva+l+++aGa+rvlt+dlH+ qiqgfFd+ lcl|FitnessBrowser__azobra:AZOBR_RS31185 69 VTIDALRRGSARRITAVLPYYGYARQDRKTGPRTPISAKLVANLITQAGANRVLTMDLHAGQIQGFFDI 137 ********************************************************************* PP TIGR01251 139 pvenlsaspklieelkkke..lknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnll 205 p +nl+a+p++ ++++++ ++++vsPD G+v ra+++ak+l+++laii+K+R+ ++ + ev+n++ lcl|FitnessBrowser__azobra:AZOBR_RS31185 138 PTDNLMAAPVFEKDIRATFedIGEVTMVSPDVGGVVRARSLAKRLDADLAIIDKRRE-RAGVSEVMNII 205 *****************99888899********************************.666******** PP TIGR01251 206 gdvegkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilv 274 gdv+++ ++++DDi+++ggTl++aa +L ++GAk+v +++thgv+sg A+ r+a + +e+++ t++i+ lcl|FitnessBrowser__azobra:AZOBR_RS31185 206 GDVKNRRCILLDDIVDSGGTLCNAAVALMDAGAKSVHAYCTHGVLSGGAVARVAVSPLEQLVTTDSIQA 274 ********************************************************************* PP TIGR01251 275 .ee.kklpkvseisvapliaeaiarihenesvsslfd 309 e + +++++++apl+a+ai+ri+e++svsslf+ lcl|FitnessBrowser__azobra:AZOBR_RS31185 275 tEAvRVSRNIRQLTIAPLLADAITRISEERSVSSLFS 311 55588899***************************95 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (311 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.39 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory