Align 3-isopropylmalate dehydratase small subunit 1; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1; EC 4.2.1.33 (characterized)
to candidate AZOBR_RS15560 AZOBR_RS15560 isopropylmalate isomerase
Query= SwissProt::P04787 (201 letters) >FitnessBrowser__azobra:AZOBR_RS15560 Length = 198 Score = 159 bits (402), Expect = 3e-44 Identities = 86/197 (43%), Positives = 117/197 (59%), Gaps = 10/197 (5%) Query: 3 EKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDEKGQQPNPEFV 62 + F T VPLD AN+DTD ++P +FL+K G+G LF+D R P F Sbjct: 2 DPFVTLTAPAVPLDIANIDTDQLLPARFLKKPRSAGYGNFLFHDER---------KPGFP 52 Query: 63 LNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPV 122 L+ P Y GA +L++ NFGCGSSRE A +AL D GF+ V+APSF DIF N+ N LL + Sbjct: 53 LDDPAYAGARVLVSDRNFGCGSSREGAVYALVDGGFRCVVAPSFGDIFAANAAKNGLLTI 112 Query: 123 TLSDAQVDELFALVKANPGIKFEVDLEAQVVKAGD-KTYSFKIDDFRRHCMLNGLDSIGL 181 TL + V EL ++ PG VDL AQ + D + F ID F++ C++ GLD + L Sbjct: 113 TLPEETVAELRRQLQEAPGAAVTVDLPAQTLSGPDGQPLPFAIDPFKKECLIEGLDDVAL 172 Query: 182 TLQHEDAIAAYENKQPA 198 TL+H+DAI A++ A Sbjct: 173 TLRHQDAIDAFDRADAA 189 Lambda K H 0.321 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 198 Length adjustment: 21 Effective length of query: 180 Effective length of database: 177 Effective search space: 31860 Effective search space used: 31860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate AZOBR_RS15560 AZOBR_RS15560 (isopropylmalate isomerase)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.29099.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.29099.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.