Align 3-isopropylmalate dehydratase subunit LeuD (EC 4.2.1.33) (characterized)
to candidate AZOBR_RS27810 AZOBR_RS27810 isopropylmalate isomerase
Query= ecocyc::LEUD-MONOMER (201 letters) >FitnessBrowser__azobra:AZOBR_RS27810 Length = 208 Score = 182 bits (461), Expect = 5e-51 Identities = 99/199 (49%), Positives = 131/199 (65%), Gaps = 3/199 (1%) Query: 1 MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDEKGQQPNPD 60 M E + TG+ PL ANVDTDAIIPK L + R+G GA LF++WRF D+ G++ PD Sbjct: 1 MPEPVNRITGIAAPLPRANVDTDAIIPKAHLLTIHRSGLGAGLFSEWRF-DDDGRE-RPD 58 Query: 61 FVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLL 120 FVLN ++ A ILLA ENFGCGSSREHA W+L D+G + VIAPSFA IF+ N N L Sbjct: 59 FVLNQAPWREAKILLAGENFGCGSSREHAVWSLMDFGIRCVIAPSFASIFHENCQKNGLA 118 Query: 121 PVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGE-KTYRFTIDAFRRHCMMNGLDSI 179 V L +A + L A +A P VD++A V A + + + FT++A RR ++ GLD I Sbjct: 119 AVTLDEAALAHLVACAQATPAATTTVDIKASRVTAPDGREFPFTMEAARRQALLEGLDEI 178 Query: 180 GLTLQHDDAIAAYEAKQPA 198 G +L+HD A+AA+EA+ A Sbjct: 179 GASLRHDAAMAAFEARDRA 197 Lambda K H 0.322 0.138 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 208 Length adjustment: 21 Effective length of query: 180 Effective length of database: 187 Effective search space: 33660 Effective search space used: 33660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate AZOBR_RS27810 AZOBR_RS27810 (isopropylmalate isomerase)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.19613.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.19613.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.