GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuA in Azospirillum brasilense Sp245

Align Probable 2-isopropylmalate synthase; EC 2.3.3.13; Alpha-IPM synthase; Alpha-isopropylmalate synthase (uncharacterized)
to candidate AZOBR_RS04265 AZOBR_RS04265 2-isopropylmalate synthase

Query= curated2:Q8TYB1
         (499 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS04265 AZOBR_RS04265
           2-isopropylmalate synthase
          Length = 534

 Score =  229 bits (583), Expect = 2e-64
 Identities = 167/518 (32%), Positives = 258/518 (49%), Gaps = 36/518 (6%)

Query: 3   DRVRIFDTTLRDGEQTPGVSLTVEEKVEIARKLDEFGVDTIEAGFPVASEGE---FEAVR 59
           +R+ ++DTTLRDG QT  V  +V +K+ IAR LD  G+D +E G+P A+  +   F    
Sbjct: 4   ERIYLYDTTLRDGAQTQDVDFSVADKIAIARDLDRLGIDYVEGGWPGANPTDDQFFAEAP 63

Query: 60  AIAGEELDA----EICGLARCVKGDIDAAIDADVDCVHVFIATSDIHLRYKLEMSREEAL 115
            +A     A       G +      + A I +    V +   T D H+   L + REE +
Sbjct: 64  DLARSTFTAFGMTRRPGRSTANDPQLAALIQSKARAVCIVGKTWDFHVDVALAIPREENI 123

Query: 116 ERAIEGVEYASDHGVTVEFSAE---DATRTDRDYLLEVYKATVEAGADRVNVPDTVGVMT 172
           E   + +           F AE   D  + +  Y     KA  EAGA  V + DT G   
Sbjct: 124 ELIADSIAALKAAKGEALFDAEHFFDGYKRNPAYAASCIKAAYEAGARWVVLCDTNGGTL 183

Query: 173 PPEMYRLTAEVVDAVDVP---VSVHCHNDFGMAVANSLAAVEAGAEQVHVTVNGIGERAG 229
           P E+  +  +V+D   +P   + +HCHND   AVANSLAAV AG   V  T+NG+GER G
Sbjct: 184 PHEIDEIVRQVIDEHGIPGDRLGIHCHNDTENAVANSLAAVRAGVRMVQGTINGLGERCG 243

Query: 230 NASLEQVVMALKALYDIELDVRTE---MLVELSRLVERLTGVVVPPNTPIVGENAFAHES 286
           NA+L  ++ +L      ++ ++     +L E+SR  +         + P VG +AFAH+ 
Sbjct: 244 NANLVSLIPSLMLKMGCDVGIKPADLPLLTEISRKFDERLNRAPNRHAPYVGASAFAHKG 303

Query: 287 GIHSHGVIKKAETYEPIRPEDVGHRRRIVLGKHAGRHAIKKKLEEMGIEV--TEEQLDEI 344
           G+H   V K   +YE + PE VG+RR+IV+   AGR  +  +L EMG+ V   +E+L+ +
Sbjct: 304 GLHVSAVEKDPSSYEHVEPEAVGNRRQIVMSDQAGRSNVIARLREMGMAVDPKDERLNRL 363

Query: 345 VRRVKELGDKGKR--VTEDDLEAIARDVVGEVPESEAAVKLEEIAVMTGNKFT------- 395
           +  VK+   +G      E   E + R  +GEVP+      L+   V    ++        
Sbjct: 364 LDIVKQRDTEGYAYDTAEASFELLVRRELGEVPD---YFTLKRFHVTDERRYNAKGELVV 420

Query: 396 -PTASVRVYLDGEEHEAASTGVGSVDAAIRALREAIEELGM---DVELKEYRLE--AITG 449
              A VRV + G+E+   ++G G V+A   A+R+A+E L      V+L +YR+   A   
Sbjct: 421 ESEAVVRVKIGGKEYHEVASGNGPVNALDTAMRKALEPLYPLLDGVKLSDYRVRILAAKD 480

Query: 450 GTDALAEVTVRLEDEDGNVTTARGAAEDIVMASVKAFV 487
           GT A+  V +R  + DG   +  G + +I+ AS++A V
Sbjct: 481 GTGAMPRVLIRSRNGDGQEWSTLGVSTNIIEASMEALV 518


Lambda     K      H
   0.315    0.133    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 560
Number of extensions: 28
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 499
Length of database: 534
Length adjustment: 35
Effective length of query: 464
Effective length of database: 499
Effective search space:   231536
Effective search space used:   231536
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory