GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapA in Azospirillum brasilense Sp245

Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate AZOBR_RS08420 AZOBR_RS08420 dihydrodipicolinate synthase

Query= BRENDA::Q07607
         (292 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS08420 AZOBR_RS08420
           dihydrodipicolinate synthase
          Length = 291

 Score =  329 bits (844), Expect = 4e-95
 Identities = 163/291 (56%), Positives = 208/291 (71%), Gaps = 1/291 (0%)

Query: 1   MFEGSITALVTPFADDRIDEVALHDLVEWQIEEGSFGLVPCGTTGESPTLSKSEHEQVVE 60
           M  GSI AL+TPF + ++DE A    VEWQ+ +G+ GLVPCGTTGESPTLS  EH +VVE
Sbjct: 1   MLYGSIVALLTPFKNGKVDEAAFQSFVEWQVAQGTHGLVPCGTTGESPTLSHEEHNRVVE 60

Query: 61  ITIKTANGRVPVIAGAGSNSTAEAIAFVRHAQNAGADGVLIVSPYYNKPTQEGIYQHFKA 120
           + I+ A G+VPV+AG GSNST EAI+  +HA+ AGA   L+V+PYYNKPTQEG+YQHFKA
Sbjct: 61  LCIEAAGGKVPVVAGTGSNSTEEAISLTQHAKKAGAAAALVVTPYYNKPTQEGLYQHFKA 120

Query: 121 IDAASTIPIIVYNIPGRSAIEIHVETLARIFEDCPNVKGVKDATGNLLRPSLERMACGED 180
           I  A+ +PI++YNIPGRS +++ V T+AR+ +  PN+ GVKDAT +L RP       G D
Sbjct: 121 IHDAADLPIVIYNIPGRSVVDMSVATMARLAK-LPNIIGVKDATADLARPVRLLQDVGPD 179

Query: 181 FNLLTGEDGTALGYMAHGGHGCISVTANVAPALCADFQQACLNGDFAAALKLQDRLMPLH 240
           F  L+GED TAL + A GG GCISVTAN+APA CA  Q A   GD A A K +D L PLH
Sbjct: 180 FIQLSGEDATALAFNAQGGVGCISVTANIAPAQCAAMQDAWRKGDLATAYKYRDLLTPLH 239

Query: 241 RALFLETNPAGAKYALQRLGRMRGDLRLPLVTISPSFQEEIDDAMRHAGIL 291
            ++F+ET+PA  KYA   LG+   ++RLPLV  S S +  + DAM+ AG+L
Sbjct: 240 DSMFVETSPAPVKYAASLLGKSSDEVRLPLVAASESTRTTVRDAMKKAGLL 290


Lambda     K      H
   0.319    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 290
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 292
Length of database: 291
Length adjustment: 26
Effective length of query: 266
Effective length of database: 265
Effective search space:    70490
Effective search space used:    70490
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate AZOBR_RS08420 AZOBR_RS08420 (dihydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00674.hmm
# target sequence database:        /tmp/gapView.27013.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00674  [M=286]
Accession:   TIGR00674
Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
     4e-106  340.0   0.0   4.6e-106  339.8   0.0    1.0  1  lcl|FitnessBrowser__azobra:AZOBR_RS08420  AZOBR_RS08420 dihydrodipicolinat


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__azobra:AZOBR_RS08420  AZOBR_RS08420 dihydrodipicolinate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  339.8   0.0  4.6e-106  4.6e-106       1     285 [.       4     286 ..       4     287 .. 0.99

  Alignments for each domain:
  == domain 1  score: 339.8 bits;  conditional E-value: 4.6e-106
                                 TIGR00674   1 gvltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvp 69 
                                               g+++Al+TPfk+ + vd aa+++ +e q+++g+ ++v++GtTGEs+tLs+eE+++v+e+ +e + ++vp
  lcl|FitnessBrowser__azobra:AZOBR_RS08420   4 GSIVALLTPFKNGK-VDEAAFQSFVEWQVAQGTHGLVPCGTTGESPTLSHEEHNRVVELCIEAAGGKVP 71 
                                               589********998.****************************************************** PP

                                 TIGR00674  70 viaGtgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgv 138
                                               v+aGtgsn+teeai+lt++a+k+g++++lvvtPyYnkPtqeGly+hfkai+++++lPi++Yn+P+R++v
  lcl|FitnessBrowser__azobra:AZOBR_RS08420  72 VVAGTGSNSTEEAISLTQHAKKAGAAAALVVTPYYNKPTQEGLYQHFKAIHDAADLPIVIYNIPGRSVV 140
                                               ********************************************************************* PP

                                 TIGR00674 139 slepetvkrLaeeveivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnva 207
                                               ++++ t++rLa+ ++i+++K+a+ dl+r +++ + ++ df  lsG+Da++l++ a+G+ G iSV++n+a
  lcl|FitnessBrowser__azobra:AZOBR_RS08420 141 DMSVATMARLAKLPNIIGVKDATADLARPVRLLQDVGPDFIQLSGEDATALAFNAQGGVGCISVTANIA 209
                                               ********************************************************************* PP

                                 TIGR00674 208 pkelkemvkaalegdteeareihqkllklfkalfietNPipvKtalallgliekdelRlPLtelseekk 276
                                               p +++ m  a+ +gd + a + +  l++l++ +f+et P pvK+a+ llg     e+RlPL+++se+++
  lcl|FitnessBrowser__azobra:AZOBR_RS08420 210 PAQCAAMQDAWRKGDLATAYKYRDLLTPLHDSMFVETSPAPVKYAASLLGKSSD-EVRLPLVAASESTR 277
                                               **************************************************9988.************** PP

                                 TIGR00674 277 eklkevlke 285
                                               +++++++k+
  lcl|FitnessBrowser__azobra:AZOBR_RS08420 278 TTVRDAMKK 286
                                               *****9986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (286 nodes)
Target sequences:                          1  (291 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 9.65
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory