Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate AZOBR_RS03470 AZOBR_RS03470 succinyl-diaminopimelate desuccinylase
Query= BRENDA::P44514 (377 letters) >FitnessBrowser__azobra:AZOBR_RS03470 Length = 397 Score = 291 bits (746), Expect = 2e-83 Identities = 164/380 (43%), Positives = 229/380 (60%), Gaps = 10/380 (2%) Query: 6 VSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFND-----TLNLWAKHGTSEP 60 V++AQ LIR PS++P D G ++ L LGF + F + NL+A+ GT P Sbjct: 16 VAVAQALIRCPSVTPEDGGALGVLEAALAPLGFVCHRLRFEEEGTAPVDNLYARLGTEGP 75 Query: 61 VIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKA-- 118 FAGHTDVVP G+ WS PF+AEI +G LYGRGA DMKG++AA + AA +VKA Sbjct: 76 NFCFAGHTDVVPPGELKGWSIDPFAAEIHNGRLYGRGAVDMKGAIAAFVAAAARHVKAVK 135 Query: 119 --NPNHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKN 176 KG+I+LLIT DEE A +GT V++ L A+ EK+ C+VGEP++ K LGD++K Sbjct: 136 ETGDAPKGSISLLITGDEEGVAINGTRKVLDWLQAKGEKLDACVVGEPTNPKALGDMIKI 195 Query: 177 GRRGSITGNLYIQGIQGHVAYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIAN 236 GRRGS+T L + G QGHVAYPHLA+NP+ + A L +T D G F P++L++ Sbjct: 196 GRRGSMTAFLTVHGAQGHVAYPHLADNPLPRLARMLTAITAEPLDAGTPHFQPSNLELTT 255 Query: 237 IHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLT 296 I G ++NVIPA+ N+R+ T + + + E L+ Y ++ +SG FLT Sbjct: 256 IDVGNPAHNVIPAQGKATLNIRFNDLHTADTLLAWLRERLDGVGGSYELDHFVSGDSFLT 315 Query: 297 KPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVS 356 PG L + + A E G P+ T GGTSD RFI VVEFG + T+HKV+E + Sbjct: 316 PPGPLTELVADAAERVTGRRPEYSTTGGTSDARFIKNF-CPVVEFGLVGQTMHKVDEHTA 374 Query: 357 VEDLGKCGEIYHKMLVNLLD 376 ++DL + +IY ++L N+ D Sbjct: 375 LDDLTRLTDIYGEVLRNVFD 394 Lambda K H 0.316 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 447 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 397 Length adjustment: 30 Effective length of query: 347 Effective length of database: 367 Effective search space: 127349 Effective search space used: 127349 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate AZOBR_RS03470 AZOBR_RS03470 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.4107.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-130 420.4 0.0 3.4e-130 420.3 0.0 1.0 1 lcl|FitnessBrowser__azobra:AZOBR_RS03470 AZOBR_RS03470 succinyl-diaminopi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__azobra:AZOBR_RS03470 AZOBR_RS03470 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 420.3 0.0 3.4e-130 3.4e-130 3 369 .. 17 391 .. 15 392 .. 0.96 Alignments for each domain: == domain 1 score: 420.3 bits; conditional E-value: 3.4e-130 TIGR01246 3 elakeLisrksvtPndagaqeliaerLkklgfeieilefed.....tknlwatrgteepvlvfaGhtDv 66 ++a+ Li+ +svtP+d ga+ ++++ L lgf +++l+fe+ + nl+a+ gte p+++faGhtDv lcl|FitnessBrowser__azobra:AZOBR_RS03470 17 AVAQALIRCPSVTPEDGGALGVLEAALAPLGFVCHRLRFEEegtapVDNLYARLGTEGPNFCFAGHTDV 85 57899*********************************9874444468999****************** PP TIGR01246 67 vPaGelekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadh....kGslsllitsDee 131 vP Gel+ Ws dpf++e+++G+lygrGa+Dmkg++aafv+aa r+vk+ + kGs+sllit Dee lcl|FitnessBrowser__azobra:AZOBR_RS03470 86 VPPGELKGWSIDPFAAEIHNGRLYGRGAVDMKGAIAAFVAAAARHVKAVKETgdapKGSISLLITGDEE 154 *********************************************987655333359************ PP TIGR01246 132 geaidGtkkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenP 200 g ai+Gt+kv+++l+++ e++d +vvgeP+ k+lGD+ikiGrrGs+t+ l+++G qGhvaYPh+a+nP lcl|FitnessBrowser__azobra:AZOBR_RS03470 155 GVAINGTRKVLDWLQAKGEKLDACVVGEPTNPKALGDMIKIGRRGSMTAFLTVHGAQGHVAYPHLADNP 223 ********************************************************************* PP TIGR01246 201 vhkavpvlkeliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskve 269 +++++++l++++a+ lD G+ +f+ps+l+++ i++g+ a nviP++ k++ n+rf+ +++++l ++ lcl|FitnessBrowser__azobra:AZOBR_RS03470 224 LPRLARMLTAITAEPLDAGTPHFQPSNLELTTIDVGNPAHNVIPAQGKATLNIRFNDLHTADTLLAWLR 292 ********************************************************************* PP TIGR01246 270 kildkhkldYelewklsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelG 338 + ld + Yel++ +sg++flt g l++ va+a e+v++++pe st+GGtsDarfi+++ + vve+G lcl|FitnessBrowser__azobra:AZOBR_RS03470 293 ERLDGVGGSYELDHFVSGDSFLTPPGPLTELVADAAERVTGRRPEYSTTGGTSDARFIKNF-CPVVEFG 360 *************************************************************.******* PP TIGR01246 339 lvndtihkvneavkiedleklsevyekllee 369 lv +t+hkv+e++ ++dl +l+++y ++l++ lcl|FitnessBrowser__azobra:AZOBR_RS03470 361 LVGQTMHKVDEHTALDDLTRLTDIYGEVLRN 391 ***************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (397 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.94 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory