Align Homocitrate synthase AksA; EC 2.3.3.14; (R)-homo(2)citrate synthase; EC 2.3.3.-; (R)-homo(3)citrate synthase; EC 2.3.3.- (uncharacterized)
to candidate AZOBR_RS04265 AZOBR_RS04265 2-isopropylmalate synthase
Query= curated2:Q8TW28 (397 letters) >FitnessBrowser__azobra:AZOBR_RS04265 Length = 534 Score = 183 bits (464), Expect = 1e-50 Identities = 127/368 (34%), Positives = 194/368 (52%), Gaps = 24/368 (6%) Query: 17 DEVIVYDTTLRDGEQTPGVSFTPEQKLEIAHLLDELGVQQIEAGFPVVSEGERDAVRRIA 76 + + +YDTTLRDG QT V F+ K+ IA LD LG+ +E G+P + + D A Sbjct: 4 ERIYLYDTTLRDGAQTQDVDFSVADKIAIARDLDRLGIDYVEGGWPGANPTD-DQFFAEA 62 Query: 77 HEGLNADILCLARTLRGDVDAALDCDVDGVITFIA--------TSELHLKHKLRMSREEV 128 + + T R A D + +I A T + H+ L + REE Sbjct: 63 PDLARSTFTAFGMTRRPGRSTANDPQLAALIQSKARAVCIVGKTWDFHVDVALAIPREEN 122 Query: 129 LERIADTV---EYAKDHGLWVAFSAEDGTRTEFEFLERVYRTAEECGADRVHATDTVGVM 185 +E IAD++ + AK L+ A DG + + + A E GA V DT G Sbjct: 123 IELIADSIAALKAAKGEALFDAEHFFDGYKRNPAYAASCIKAAYEAGARWVVLCDTNGGT 182 Query: 186 IPAAMRLFVAKIREVVDLP---IGVHCHDDFGMAVANSLAAVEAGAQAISTTVNGIGERA 242 +P + V ++ + +P +G+HCH+D AVANSLAAV AG + + T+NG+GER Sbjct: 183 LPHEIDEIVRQVIDEHGIPGDRLGIHCHNDTENAVANSLAAVRAGVRMVQGTINGLGERC 242 Query: 243 GNAALEEVIMALKELYGIDPGF---NTEVLAELSRKVSEYSGIDVPPNK--AVVGENAFR 297 GNA L +I +L G D G + +L E+SRK E ++ PN+ VG +AF Sbjct: 243 GNANLVSLIPSLMLKMGCDVGIKPADLPLLTEISRKFDE--RLNRAPNRHAPYVGASAFA 300 Query: 298 HESGIHVAAVLEEPRTYEPIDPKEVGMNRKIVLGKHTGRKAVVAKLEELG--VEPEEEIV 355 H+ G+HV+AV ++P +YE ++P+ VG R+IV+ GR V+A+L E+G V+P++E + Sbjct: 301 HKGGLHVSAVEKDPSSYEHVEPEAVGNRRQIVMSDQAGRSNVIARLREMGMAVDPKDERL 360 Query: 356 EEVLKRIK 363 +L +K Sbjct: 361 NRLLDIVK 368 Lambda K H 0.317 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 534 Length adjustment: 33 Effective length of query: 364 Effective length of database: 501 Effective search space: 182364 Effective search space used: 182364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory