Align ornithine aminotransferase (EC 2.6.1.13) (characterized)
to candidate AZOBR_RS19630 AZOBR_RS19630 4-aminobutyrate aminotransferase
Query= BRENDA::Q98TS5 (439 letters) >FitnessBrowser__azobra:AZOBR_RS19630 Length = 428 Score = 208 bits (530), Expect = 2e-58 Identities = 141/415 (33%), Positives = 220/415 (53%), Gaps = 50/415 (12%) Query: 58 LPVALERGKGVYVWDVEGRRYFDFLSAYSAVNQGHCHPKILDALKSQADKLTLTSRAFYN 117 +PV ++R + +WDVEG R+ DF + +N GH HPKI++A+K+Q D+ T T Sbjct: 22 MPVYVDRAENAELWDVEGNRFIDFAGGIAVLNTGHRHPKIIEAVKAQLDRFTHTCA---- 77 Query: 118 DVLGEYEEYITKIFGYNKVLP---------MNTGVEGGETACKLARKWAYTVKGIPKYKA 168 ++ YE ++T N ++P TG E E A K+AR A+T G P Sbjct: 78 -MVTPYESFVTLAERLNALVPGSTPKKTAFFTTGAEAVENAVKIAR--AHT--GRPG--- 129 Query: 169 QIIFAAGNFWGRTMSAISSSTDPSSYE-GFGPFMPGFKIIPY----------NDLPALER 217 +I +G F GRT+ A++ + Y+ GFGPF P+ + L ALE+ Sbjct: 130 -VIAFSGAFHGRTLLAMALTGKVVPYKVGFGPFPAEVYHAPFPNAYRGVSVQDSLKALEQ 188 Query: 218 ALQDP----NVAAFMVEPIQGEAGVIVPDEGYLTGVRQLCTAHNVLFIADEVQTGLARTG 273 + VAA +VEP+QGE G + +L +R++C + +L I DE+QTG ARTG Sbjct: 189 LFKSDVDATRVAAIIVEPVQGEGGFNIAPPEFLQALRKICDENGILLIIDEIQTGFARTG 248 Query: 274 KMLAVDHENVRPDLVILGKALSGGVYPVSAVLCDDEVMLTIKPGEHGSTYGGNPLGCRVA 333 KM A++H V PDL+ + K+L+GG +P+SAV E+M PG G TY G+PL A Sbjct: 249 KMFAIEHSGVEPDLMTMAKSLAGG-FPLSAVTGKAEIMDAPIPGGIGGTYAGSPLATTAA 307 Query: 334 MASLEVIEEEKLAENANXMGELL----RAELMKTPSDIVTAVRGKGLLNAIVIKQSKDCD 389 +A L+VIEEEKL + +N +GE + R + ++ VR G + A+ + + + Sbjct: 308 LAVLDVIEEEKLIQRSNDLGERIAGRFRTMAQRNTLSVIGDVRNLGGMIAMELVKDRGTK 367 Query: 390 ------AWKVCLRLRDNG--LLAKPTHGDIIRLAPPLTIKEDEIRECSEIIHKTL 436 + + + G LL+ T+G++IR+ PLT + + E +II ++L Sbjct: 368 EPAAELTKALVAKAAEKGLVLLSCGTYGNVIRILVPLTASDALVDEGLDIIERSL 422 Lambda K H 0.318 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 441 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 428 Length adjustment: 32 Effective length of query: 407 Effective length of database: 396 Effective search space: 161172 Effective search space used: 161172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory