GapMind for Amino acid biosynthesis

 

Aligments for a candidate for serB in Azospirillum brasilense Sp245

Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate AZOBR_RS06540 AZOBR_RS06540 phosphoserine phosphatase

Query= SwissProt::Q12A06
         (236 letters)



>lcl|FitnessBrowser__azobra:AZOBR_RS06540 AZOBR_RS06540
           phosphoserine phosphatase
          Length = 303

 Score =  170 bits (431), Expect = 3e-47
 Identities = 100/224 (44%), Positives = 138/224 (61%), Gaps = 6/224 (2%)

Query: 9   GLVVNVATPDLKLSDFKLIAFDMDSTLINIECVDEIADAAGRKAEVAAITEAAMRGEISD 68
           GL V+V          +L+  DM+ST+I  E +DE+ D  G K  +AAIT  AM GEI D
Sbjct: 73  GLAVDVIAQKPGSRKKRLLVADMESTIIEQEMLDELGDYVGLKDHIAAITARAMNGEI-D 131

Query: 69  YKESLRQRVALLKGVSVASMDEVYRTRLRLNPGAARLVQACKDAGLKVLLVSGGFTFFTD 128
           +K ++R+RVALLKG++ + +DEV++ R  L PGA  LV   +  G   +LVSGGF  FT+
Sbjct: 132 FKGAVRERVALLKGLNESVVDEVWQ-RATLMPGARTLVSTMRANGATCVLVSGGFRCFTE 190

Query: 129 RIRDELGIDYTRSNVLETTDGLLTGRMVDQPWGDICDGEEKRKMLLETCGQLGISPRQAI 188
           R+R  +G D  R NVLE  DG++TG +V+     I D + K + LL   G+  +   + +
Sbjct: 191 RVRQWVGFDDDRGNVLEVVDGVMTGAVVEP----ILDKDSKLEALLAYAGERHVPTVETM 246

Query: 189 AMGDGANDLPMMGEAGLSVAYHAKPRVREQAMVAINEGGLDRLL 232
           A+GDGANDLPM+  AGL VA+HAKP V  QA   ++ G L  LL
Sbjct: 247 AVGDGANDLPMLLAAGLGVAFHAKPTVAAQARARVDHGDLTALL 290


Lambda     K      H
   0.319    0.136    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 192
Number of extensions: 9
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 236
Length of database: 303
Length adjustment: 25
Effective length of query: 211
Effective length of database: 278
Effective search space:    58658
Effective search space used:    58658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate AZOBR_RS06540 AZOBR_RS06540 (phosphoserine phosphatase)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00338.hmm
# target sequence database:        /tmp/gapView.17796.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00338  [M=219]
Accession:   TIGR00338
Description: serB: phosphoserine phosphatase SerB
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    5.2e-66  208.4   0.1    6.9e-66  208.0   0.1    1.1  1  lcl|FitnessBrowser__azobra:AZOBR_RS06540  AZOBR_RS06540 phosphoserine phos


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__azobra:AZOBR_RS06540  AZOBR_RS06540 phosphoserine phosphatase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  208.0   0.1   6.9e-66   6.9e-66       8     216 ..      82     290 ..      76     292 .. 0.98

  Alignments for each domain:
  == domain 1  score: 208.0 bits;  conditional E-value: 6.9e-66
                                 TIGR00338   8 skllkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslreRvkllkglpvel 76 
                                               ++  +kk+l+v D++st+ie+E++de++ ++G ++++++iT rAm+ge+dFk ++reRv+llkgl++++
  lcl|FitnessBrowser__azobra:AZOBR_RS06540  82 KPGSRKKRLLVADMESTIIEQEMLDELGDYVGLKDHIAAITARAMNGEIDFKGAVRERVALLKGLNESV 150
                                               566789*************************************************************** PP

                                 TIGR00338  77 lkkveeklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLevedgkltGkveg 145
                                               +++v ++ +l++G++ lv++++ +g   +++SGgF+ ++e++++  g d   +N Lev dg +tG v  
  lcl|FitnessBrowser__azobra:AZOBR_RS06540 151 VDEVWQRATLMPGARTLVSTMRANGATCVLVSGGFRCFTERVRQWVGFDDDRGNVLEVVDGVMTGAVVE 219
                                               ********************************************************************* PP

                                 TIGR00338 146 eivdesakaktllkllekegislektvavGDGanDlsmikaAglgiafnakpvlkekadiviekkdltd 214
                                               +i+d+++k + ll  + + ++++ +t+avGDGanDl+m+ aAglg+af+akp +  +a + +++ dlt+
  lcl|FitnessBrowser__azobra:AZOBR_RS06540 220 PILDKDSKLEALLAYAGERHVPTVETMAVGDGANDLPMLLAAGLGVAFHAKPTVAAQARARVDHGDLTA 288
                                               *******************************************************************99 PP

                                 TIGR00338 215 il 216
                                               +l
  lcl|FitnessBrowser__azobra:AZOBR_RS06540 289 LL 290
                                               86 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (219 nodes)
Target sequences:                          1  (303 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 9.41
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory