Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate GFF2528 Psest_2578 O-succinylhomoserine sulfhydrylase
Query= BRENDA::Q5H4T8 (397 letters) >FitnessBrowser__psRCH2:GFF2528 Length = 403 Score = 315 bits (807), Expect = 1e-90 Identities = 172/390 (44%), Positives = 250/390 (64%), Gaps = 13/390 (3%) Query: 13 RALSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSP--------GEHQGFEYSRTHNP 64 + + L TLA+ GQ P G P++ TS+Y S G+ G YSR NP Sbjct: 15 QGVGLDTLAVRAGQRRTPE-GEHGEPLFFTSSYVFRSAADAAARFAGDVPGNVYSRYTNP 73 Query: 65 TRFAYERCVAALEGGTRAFAFASGMAAT-STVMELLDAGSHVVAMDDLYGGTFRLFERVR 123 T A+E +AALEG +A A ASGMAA +TVM L AG HV+ ++G T LFE+ Sbjct: 74 TVRAFEERIAALEGAEQAVATASGMAAILATVMSLCAAGDHVLVSRSVFGATVSLFEKYL 133 Query: 124 RRTAGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTV 183 +R G+ +V LTD +A+++A + +TK+V++E+P+NP+ +LVDIAA+A + G + Sbjct: 134 KRF-GVQVDYVPLTDFSAWESAFQENTKLVFVESPSNPLAELVDIAALAKLCHAKGAMLA 192 Query: 184 VDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIG 243 VDN F +P+LQ+PL+LGAD+V+HSATKY++G +GG+ V G + ++ E + FL+ + G Sbjct: 193 VDNCFCTPVLQQPLALGADIVIHSATKYIDGQGRCLGGV-VAGRSEQMKELVGFLRTA-G 250 Query: 244 GVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAK 303 PF++++ L+GL+TL LRM+AHC +A LA+WLE P IE+V Y GL SHPQH LAK Sbjct: 251 PTLSPFNAWVFLKGLETLRLRMQAHCASAQELAEWLEQQPGIERVYYAGLPSHPQHELAK 310 Query: 304 RQMSGFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARR 363 RQ GFG +VS + GG +AA RF + T L ++ +LG ++ + HP TH + R Sbjct: 311 RQQKGFGAVVSFEVAGGKEAAWRFIDATRLISITANLGDSKTTITHPGSTTHGRLSAEDR 370 Query: 364 EQLGISDALVRLSVGIEDLGDLRGDLERAL 393 GI D+L+R++VG+ED+ DL+ DL R L Sbjct: 371 ATAGIRDSLIRVAVGLEDVADLKADLARGL 400 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 403 Length adjustment: 31 Effective length of query: 366 Effective length of database: 372 Effective search space: 136152 Effective search space used: 136152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory