Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate GFF3618 Psest_3685 OAH/OAS sulfhydrylase
Query= BRENDA::Q5H4T8 (397 letters) >FitnessBrowser__psRCH2:GFF3618 Length = 425 Score = 275 bits (702), Expect = 2e-78 Identities = 167/422 (39%), Positives = 231/422 (54%), Gaps = 45/422 (10%) Query: 15 LSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEH---------QGFEYSRTHNPT 65 + L TLAIH G SPDP+T AV PIY T++YA +H G Y+R NPT Sbjct: 1 MKLETLAIHAGYSPDPTTRAVAVPIYQTTSYAFDDT-QHGADLFDLKVPGNIYTRIMNPT 59 Query: 66 RFAYERCVAALEGGTRAFAFASGMAA-TSTVMELLDAGSHVVAMDDLYGGTFRLFERVRR 124 E+ VAALEGG A A ASGMAA T + + + G ++V++ LYGGT+ LF Sbjct: 60 TDVLEQRVAALEGGVAALAVASGMAAITYAIQTIAEVGDNIVSVAKLYGGTYNLFAHTLP 119 Query: 125 RTAGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVV 184 R G++ F D AA ++ I TK V+ E+ NP ++D+AA+A A +HG+ +V Sbjct: 120 RQ-GIEVRFAAHDDIAALESLIDERTKAVFCESIGNPAGNVIDLAALAEAAHRHGVPLIV 178 Query: 185 DNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDN---AELAEQMAFLQ-- 239 DNT A+PML RP GAD+VVHS TKY+ GH +GGI V A+ ++ A L Sbjct: 179 DNTVATPMLCRPFEHGADIVVHSLTKYMGGHGTSIGGIVVDSGKFPWAQHKKRFALLNTP 238 Query: 240 ---------------------------NSIGGVQGPFDSFLALRGLKTLPLRMRAHCENA 272 ++G PF+SFL L+GL+TL LRM HCENA Sbjct: 239 DVSYHGVTYTEAFGPAAFIGRCRVVPLRNMGAAISPFNSFLILQGLETLALRMERHCENA 298 Query: 273 LALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMSGF-GGIVSIVLKGGFDAAKRFCEKT 331 L +A++L+ HP + V Y GL HP+H LA+R M G I+ ++GG +A RF + Sbjct: 299 LKVAEFLQAHPQVAWVKYAGLPDHPEHELARRYMGGTPASILCFGIEGGIEAGARFIDAL 358 Query: 332 ELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVRLSVGIEDLGDLRGDLER 391 +L ++G +SL HPA TH + + G+S L+RLS+GIE + D+ DL + Sbjct: 359 KLVVRLVNIGDAKSLACHPASTTHRQLNADELARAGVSQDLIRLSIGIEHIDDILADLAQ 418 Query: 392 AL 393 AL Sbjct: 419 AL 420 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 540 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 425 Length adjustment: 31 Effective length of query: 366 Effective length of database: 394 Effective search space: 144204 Effective search space used: 144204 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory