Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate GFF2953 Psest_3009 L-threonine-O-3-phosphate decarboxylase
Query= curated2:A7MJP4 (360 letters) >FitnessBrowser__psRCH2:GFF2953 Length = 329 Score = 79.7 bits (195), Expect = 1e-19 Identities = 44/123 (35%), Positives = 73/123 (59%), Gaps = 2/123 (1%) Query: 136 AIAEQLDGVKVIFVCSPNNPTGQLINPQDL-RTLLEMARGKAIVVADEAYIEFCPQATLA 194 ++ LD + V+ V +PNNPTGQL+ PQ L ++A +V DEA+++ P+ +LA Sbjct: 117 SVPRALDQLDVLVVVNPNNPTGQLVAPQRLLEWRSDLAAYGGWLVVDEAFMDCTPEHSLA 176 Query: 195 GWLGEYPHLVVLRTLSKAFALAGLRCGFTLANEEVINLLLKVIAPYPLSTPVADIAAQAL 254 P L+VLR+ K F LAG R GF LA+ ++ L +++ P+ ++ P +AA+ L Sbjct: 177 AH-SHLPGLIVLRSFGKFFGLAGARLGFVLAHAGLLRSLARLLGPWTVNGPTRQLAAELL 235 Query: 255 SPE 257 + + Sbjct: 236 ADQ 238 Lambda K H 0.320 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 329 Length adjustment: 29 Effective length of query: 331 Effective length of database: 300 Effective search space: 99300 Effective search space used: 99300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory