GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisC in Pseudomonas stutzeri RCH2

Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate GFF2953 Psest_3009 L-threonine-O-3-phosphate decarboxylase

Query= curated2:A7MJP4
         (360 letters)



>FitnessBrowser__psRCH2:GFF2953
          Length = 329

 Score = 79.7 bits (195), Expect = 1e-19
 Identities = 44/123 (35%), Positives = 73/123 (59%), Gaps = 2/123 (1%)

Query: 136 AIAEQLDGVKVIFVCSPNNPTGQLINPQDL-RTLLEMARGKAIVVADEAYIEFCPQATLA 194
           ++   LD + V+ V +PNNPTGQL+ PQ L     ++A     +V DEA+++  P+ +LA
Sbjct: 117 SVPRALDQLDVLVVVNPNNPTGQLVAPQRLLEWRSDLAAYGGWLVVDEAFMDCTPEHSLA 176

Query: 195 GWLGEYPHLVVLRTLSKAFALAGLRCGFTLANEEVINLLLKVIAPYPLSTPVADIAAQAL 254
                 P L+VLR+  K F LAG R GF LA+  ++  L +++ P+ ++ P   +AA+ L
Sbjct: 177 AH-SHLPGLIVLRSFGKFFGLAGARLGFVLAHAGLLRSLARLLGPWTVNGPTRQLAAELL 235

Query: 255 SPE 257
           + +
Sbjct: 236 ADQ 238


Lambda     K      H
   0.320    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 282
Number of extensions: 15
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 360
Length of database: 329
Length adjustment: 29
Effective length of query: 331
Effective length of database: 300
Effective search space:    99300
Effective search space used:    99300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory