GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisF in Pseudomonas stutzeri RCH2

Align Imidazole glycerol phosphate synthase subunit HisF; EC 4.3.2.10; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF (uncharacterized)
to candidate GFF155 Psest_0155 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase

Query= curated2:A6TKT6
         (252 letters)



>lcl|FitnessBrowser__psRCH2:GFF155 Psest_0155
           phosphoribosylformimino-5-aminoimidazole carboxamide
           ribotide isomerase
          Length = 247

 Score =  104 bits (259), Expect = 2e-27
 Identities = 70/231 (30%), Positives = 117/231 (50%), Gaps = 13/231 (5%)

Query: 6   IIPCLDVRKGRVVK---GVNFVDIKDAGDPVALARAYNDQGADEIVFLDITASHEERYIL 62
           IIP +D++ G  V+   G+       + DPVA+A  + + G   +  +D+  + E + + 
Sbjct: 3   IIPAIDLKDGACVRLRQGLMDDATVFSDDPVAMAAKWVEAGCRRLHLVDLNGAFEGQPVN 62

Query: 63  LDVVKKTSEEI-FIPLTVGGGIRTVEDMRQIIKSGADKVSINSSAVKNPSMITDCARQFG 121
            +VV   ++    +P+ +GGGIRT+E +   +++G   V I + AVK P  +T+  R F 
Sbjct: 63  GEVVTAIAKRYPDLPIQIGGGIRTLETIEHYVRAGVSYVIIGTKAVKEPGFVTEACRAFP 122

Query: 122 SQAVVIAMDVKRGADGRYEVYVRGGREKTGLEAVDWARRVAQLGAGEILLTSMDRDGTKS 181
            + V++ +D K G      V   G  E + ++AVD ARR    G   I+ T + +DG   
Sbjct: 123 GK-VIVGLDAKDGF-----VATDGWAEVSSVQAVDLARRFEADGVSAIVYTDIAKDGMMQ 176

Query: 182 GYDLEITKRISQAVNIPVIASGG---AGSVQDFADAFIEGQADAALAASLF 229
           G ++E T  ++ A  IPVIASGG    G +Q   D    G   A    +++
Sbjct: 177 GCNVEATVALANASRIPVIASGGIHNIGDIQKLLDTNTPGIVGAITGRAIY 227


Lambda     K      H
   0.319    0.136    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 164
Number of extensions: 9
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 252
Length of database: 247
Length adjustment: 24
Effective length of query: 228
Effective length of database: 223
Effective search space:    50844
Effective search space used:    50844
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory