Align ATP phosphoribosyltransferase; ATP-PRT; ATP-PRTase; EC 2.4.2.17 (uncharacterized)
to candidate GFF3236 Psest_3299 ATP phosphoribosyltransferase
Query= curated2:Q6FEC9 (228 letters) >FitnessBrowser__psRCH2:GFF3236 Length = 210 Score = 281 bits (718), Expect = 9e-81 Identities = 146/206 (70%), Positives = 171/206 (83%), Gaps = 4/206 (1%) Query: 22 LTLALSKGRILKETLPLLEAAGINLLEDPEKSRKLIFPTTHQKVRILILRASDVPTYVEN 81 LT+ALSKGRIL +TLPLL AAGI E+P+KSRKLI PTT VR+LI+RA+DVPTYVE+ Sbjct: 2 LTIALSKGRILDDTLPLLAAAGIVPTENPDKSRKLIIPTTQDDVRLLIVRATDVPTYVEH 61 Query: 82 GAADFGVAGKDVLMEHGAQHVYELLDLKIANCKLMTAGKVGMQHPKGRLKIATKYVNLTR 141 GAAD GVAGKDVLME+G Q +YE LDL+IANCKLMTAGKVG PKGRL++ATK+VN+ + Sbjct: 62 GAADLGVAGKDVLMEYGGQGLYEPLDLRIANCKLMTAGKVGAPEPKGRLRVATKFVNVAK 121 Query: 142 QYYASLGEQVDVIKLYGSMELAPLVGLGDYIVDVVDTGNTLRANGLEPLEEIMKVSSRLI 201 +YYA G QVD+IKLYGSMELAPLVGL D I+DVVDTGNTLRANGLEP E I +SSRL+ Sbjct: 122 RYYAEQGRQVDIIKLYGSMELAPLVGLADKIIDVVDTGNTLRANGLEPQELIAHISSRLV 181 Query: 202 VNKASFK----RKQALLDPILAQVEE 223 VNKAS K R QAL+D + A V++ Sbjct: 182 VNKASMKMQHARIQALIDILHAAVQQ 207 Lambda K H 0.318 0.137 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 210 Length adjustment: 22 Effective length of query: 206 Effective length of database: 188 Effective search space: 38728 Effective search space used: 38728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate GFF3236 Psest_3299 (ATP phosphoribosyltransferase)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.12603.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-58 181.9 0.0 6.7e-58 181.6 0.0 1.1 1 lcl|FitnessBrowser__psRCH2:GFF3236 Psest_3299 ATP phosphoribosyltra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF3236 Psest_3299 ATP phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 181.6 0.0 6.7e-58 6.7e-58 1 183 [] 2 182 .. 2 182 .. 0.95 Alignments for each domain: == domain 1 score: 181.6 bits; conditional E-value: 6.7e-58 TIGR00070 1 lriAlpKGrleeetlkllekaglklskke..erkliasaedeevevlllrakdiptyvekgaadlGitGkDlleE 73 l+iAl KGr++++tl ll++ag+ +++ +rkli+ +++++v++l++ra+d+ptyve+gaadlG+ GkD+l+E lcl|FitnessBrowser__psRCH2:GFF3236 2 LTIALSKGRILDDTLPLLAAAGIVPTENPdkSRKLIIPTTQDDVRLLIVRATDVPTYVEHGAADLGVAGKDVLME 76 79********************9987766699******************************************* PP TIGR00070 74 sead.vvelldlgfgkcklvlAvpeesdvesledlkegk.riATkypnltreylekkgvkveivkleGavElapl 146 + + ++e ldl++ +ckl+ A + + + g+ r+ATk++n++++y++++g +v+i+kl+G++Elapl lcl|FitnessBrowser__psRCH2:GFF3236 77 YGGQgLYEPLDLRIANCKLMTAGKVGAPEPK------GRlRVATKFVNVAKRYYAEQGRQVDIIKLYGSMELAPL 145 65555*********************96655......556*********************************** PP TIGR00070 147 lgladaIvDivetGttLrengLkiieeilessarlia 183 +glad I+D+v tG+tLr+ngL+ e i ++s+rl++ lcl|FitnessBrowser__psRCH2:GFF3236 146 VGLADKIIDVVDTGNTLRANGLEPQELIAHISSRLVV 182 **********************************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (210 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 5.32 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory