Align Histidinol-phosphatase [alternative form] (EC 3.1.3.15) (characterized)
to candidate GFF1214 Psest_1247 Archaeal fructose-1,6-bisphosphatase and related enzymes of inositol monophosphatase family
Query= reanno::azobra:AZOBR_RS03845 (260 letters) >FitnessBrowser__psRCH2:GFF1214 Length = 271 Score = 103 bits (257), Expect = 4e-27 Identities = 82/264 (31%), Positives = 130/264 (49%), Gaps = 18/264 (6%) Query: 8 PLVTLAERLADASGP-VIRQYFRTP-VAVDDKADASPVTIADREAERTIRAIIEAERPDD 65 P++ +A R A ++G ++R R ++V++K VT D+ AE++I A + P+ Sbjct: 3 PMLNIALRAARSAGELIVRSTDRLDAISVNEKEAKDYVTEIDKAAEQSIVAALRKAYPNH 62 Query: 66 GIYGEEFGT---KNLDAEWVWVIDPIDGTKSFITGRPIFGTLIALLHRGRPVLGVIDQPI 122 GI GEE G +++W+IDP+DGT +F+ G P + IA +RGR V+ P+ Sbjct: 63 GILGEEGGLLEGSGDGTDYLWIIDPLDGTTNFVRGIPHYAVSIACKYRGRLEHAVVLDPV 122 Query: 123 VRDRWLGVEGRPTLFNGQPARVRECAGGLAAATLGTTSPDLFPGADQD-------AFRRV 175 ++ + GR NG+ RV L A LGT P F D D FR + Sbjct: 123 RQEEFTASRGRGAAVNGRRLRV-SARKSLDGALLGTGFP--FKDGDMDNLDAYLNMFRSL 179 Query: 176 AG-AAKVSVYGGDCYSYGLLAAGYYDLVVESGLKLYDFAALVPVVTGAGGLMTDWDGRPL 234 G + + G +AAG +D E GL +D AA ++ AGGL++D+ G Sbjct: 180 VGQTSGLRRAGAASLDLAYVAAGRFDAFWEFGLSEWDMAAGALLIQEAGGLVSDFSGGH- 238 Query: 235 DATSSGRVVAAGDARTHRETLAAL 258 D G++V AG+ + + L A+ Sbjct: 239 DFLEKGQIV-AGNTKCFKAVLTAI 261 Lambda K H 0.320 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 271 Length adjustment: 25 Effective length of query: 235 Effective length of database: 246 Effective search space: 57810 Effective search space used: 57810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory