Align Ribose-phosphate pyrophosphokinase; RPPK; EC 2.7.6.1; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase (uncharacterized)
to candidate GFF3459 Psest_3524 ribose-phosphate pyrophosphokinase
Query= curated2:Q8TUT6 (291 letters) >FitnessBrowser__psRCH2:GFF3459 Length = 298 Score = 144 bits (362), Expect = 3e-39 Identities = 102/284 (35%), Positives = 149/284 (52%), Gaps = 13/284 (4%) Query: 15 RLAEELDAELAPVEEDRFPDGEQIVRVPPELDGTVV----VVHSMSPPQDENLVKAIITL 70 RLAE A +E RFPD E +R+P DG + V++ +E LV+ ++ Sbjct: 17 RLAEACGLTAAQIERHRFPDDELRLRLPLA-DGEAIAEQLVIYRGLDHPNEKLVELLLIA 75 Query: 71 DAARENGAEEVIAIVPYMAYSRQDRRFEPGEPVSFRAVARAVSANADALITVD--LHEPG 128 AR GA+ ++ + PY+AY RQD F PGE VS R + + ++ D LITVD LH Sbjct: 76 GEARRLGAKRLVLVTPYLAYMRQDIAFNPGEVVSQRVIGQLLAGQFDGLITVDPHLHRVA 135 Query: 129 TLKYFDVPAEN---VSAAEELGKYLAERFEGEDLVVIGPDEGARELAREVASICGVEYDH 185 TL+ VP E+ + AA L + +AER D ++IGPD A + A+ G + Sbjct: 136 TLQEA-VPLEDAVTLCAAPALARLIAERHP--DALLIGPDAEALQWIEAAAAEHGFAHGV 192 Query: 186 LEKKRLSGDEVEIHPKELDVEGRTVVLVDDMIDTGGTMVEAARALRDQGAGTLYAACTHA 245 K R +VEI EL GR VVL+DD+ +G T+ +AA L GA ++ A THA Sbjct: 193 CSKVRHGDHQVEIALPELQFAGRHVVLLDDVASSGRTLAQAAEKLLAAGAASVDVAVTHA 252 Query: 246 LLTRNAATRLLASGFEDIIATDTVPNPFEKVSVAPPVAEAVENL 289 L +A + +G + +TD + + VS+AP +AEA+ L Sbjct: 253 LFAGDALQVIRDAGVGHVWSTDCIAHGSNAVSMAPQLAEALRPL 296 Lambda K H 0.314 0.134 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 298 Length adjustment: 26 Effective length of query: 265 Effective length of database: 272 Effective search space: 72080 Effective search space used: 72080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
Align candidate GFF3459 Psest_3524 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.749.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-54 169.0 0.0 7.3e-54 168.7 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF3459 Psest_3524 ribose-phosphate pyro Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF3459 Psest_3524 ribose-phosphate pyrophosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 168.7 0.0 7.3e-54 7.3e-54 9 296 .. 11 294 .. 4 297 .. 0.91 Alignments for each domain: == domain 1 score: 168.7 bits; conditional E-value: 7.3e-54 TIGR01251 9 skelaekvaknlglelgdvevkkFadgElyvrie....esvrgkdvfiivqstsapvndalmellllidalkras 79 +++ a ++a++ gl ++e ++F+d+El r+ e++ ++ +i n++l+elll++ ++r + lcl|FitnessBrowser__psRCH2:GFF3459 11 ERAAALRLAEACGLTAAQIERHRFPDDELRLRLPladgEAI--AEQLVI-YRGLDHPNEKLVELLLIAGEARRLG 82 5667889999**********************963222344..356777.788889******************* PP TIGR01251 80 aksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseqiqgfFd.vpven...lsaspkli 150 ak++ +v Py++Y Rqd ++++e +s +++++ll+ d ++tvd H + + + vp+e+ l a+p l+ lcl|FitnessBrowser__psRCH2:GFF3459 83 AKRLVLVTPYLAYMRQDIAFNPGEVVSQRVIGQLLAGQ-FDGLITVDPHLHRVATLQEaVPLEDavtLCAAPALA 156 **************************************.************9999988888764333899***** PP TIGR01251 151 eelkkkelknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdvegkdvvivDDiisTggT 225 + ++++ + +++ PD+ a+++ +++a++ g + K+R+ + +ve+ +++ +g++vv++DD+ s+g T lcl|FitnessBrowser__psRCH2:GFF3459 157 RLIAER-HPDALLIGPDAEALQWIEAAAAEHGFAHGVCSKVRHG-DHQVEIALPELQFAGRHVVLLDDVASSGRT 229 ***997.889999******************************5.55**************************** PP TIGR01251 226 lvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilveekklpkvseisvapliaeaia 296 l++aae L +GA +v va+th++f+gdAl+ ++ agv +v +t+ i++ + +s+ap +aea++ lcl|FitnessBrowser__psRCH2:GFF3459 230 LAQAAEKLLAAGAASVDVAVTHALFAGDALQVIRDAGVGHVWSTDCIAH------GSNAVSMAPQLAEALR 294 *************************************************......8889999999999985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (298 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.94 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory