Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate GFF1581 Psest_1618 succinyl-diaminopimelate desuccinylase, proteobacterial clade
Query= BRENDA::Q9KQ52 (377 letters) >FitnessBrowser__psRCH2:GFF1581 Length = 382 Score = 480 bits (1236), Expect = e-140 Identities = 240/374 (64%), Positives = 279/374 (74%), Gaps = 1/374 (0%) Query: 4 SPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQSPLF 63 SP L LA ELI+R SVTP D GCQ LM +RL A GF IE M ED NFWA RG++ P+ Sbjct: 7 SPTLELACELINRPSVTPLDEGCQQLMTQRLAACGFAIEPMHIEDVENFWAIRGSEGPVL 66 Query: 64 VFAGHTDVVPAGPLSQWHTPPFEPTVID-GFLHGRGAADMKGSLACMIVAVERFIAEHPD 122 FAGHTDVVP GPL W PPF + + G LHGRGAADMKGSLA M+VAVERF A HPD Sbjct: 67 CFAGHTDVVPTGPLQAWQNPPFSARIDEQGMLHGRGAADMKGSLAAMVVAVERFTAAHPD 126 Query: 123 HQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRRGS 182 H+G I FLITSDEEGP +GT VVE L R + +D CIVGEPSST VGDVVKNGRRGS Sbjct: 127 HKGQIAFLITSDEEGPAHHGTKAVVERLRERGQRLDWCIVGEPSSTTLVGDVVKNGRRGS 186 Query: 183 ITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQAGT 242 + G L V+G QGHVAYPHLA NP+H A PALAELAA WD+GNA+FPPTSFQI NL AGT Sbjct: 187 LGGTLTVRGQQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQISNLNAGT 246 Query: 243 GASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTGEL 302 G +NVIPG + FNFRFSTE T E++K+R ++LD HGLD++V+W LSG PFLT+ G L Sbjct: 247 GTTNVIPGTLEAVFNFRFSTESTVEQLKQRTAAILDKHGLDWNVEWALSGLPFLTEPGAL 306 Query: 303 LAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADLE 362 L V A+ V + T+GGTSDGRFIA +G QVVELGPVNATIH+V+E + +DL+ Sbjct: 307 LDGVAKAIRSVTGRETTPSTSGGTSDGRFIATLGTQVVELGPVNATIHQVDEHILASDLD 366 Query: 363 KLTDMYQKTLNHLL 376 LTD+Y TL +LL Sbjct: 367 LLTDIYYLTLVNLL 380 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 382 Length adjustment: 30 Effective length of query: 347 Effective length of database: 352 Effective search space: 122144 Effective search space used: 122144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF1581 Psest_1618 (succinyl-diaminopimelate desuccinylase, proteobacterial clade)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.20485.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-167 543.6 0.0 1.3e-167 543.4 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF1581 Psest_1618 succinyl-diaminopimel Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF1581 Psest_1618 succinyl-diaminopimelate desuccinylase, proteobacterial clade # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 543.4 0.0 1.3e-167 1.3e-167 2 370 .] 10 379 .. 9 379 .. 0.99 Alignments for each domain: == domain 1 score: 543.4 bits; conditional E-value: 1.3e-167 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaGelekWs 76 lela+eLi+r+svtP d+g+q+l+++rL + gf+ie +++ed++n+wa rg e pvl+faGhtDvvP+G+l++W+ lcl|FitnessBrowser__psRCH2:GFF1581 10 LELACELINRPSVTPLDEGCQQLMTQRLAACGFAIEPMHIEDVENFWAIRGSEGPVLCFAGHTDVVPTGPLQAWQ 84 689************************************************************************ PP TIGR01246 77 sdpfepee.rdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerde 150 ++pf++++ ++G+l+grGaaDmkgslaa+vva+erf ++++dhkG++++litsDeeg a +Gtk+vve l+er + lcl|FitnessBrowser__psRCH2:GFF1581 85 NPPFSARIdEQGMLHGRGAADMKGSLAAMVVAVERFTAAHPDHKGQIAFLITSDEEGPAHHGTKAVVERLRERGQ 159 *****987257**************************************************************** PP TIGR01246 151 lidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffpp 225 +d+++vgePss+ +GDv+k+GrrGs+ g+l+++G qGhvaYPh+a+nP+h a+p+l+el+a+++D+Gn+ffpp lcl|FitnessBrowser__psRCH2:GFF1581 160 RLDWCIVGEPSSTTLVGDVVKNGRRGSLGGTLTVRGQQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPP 234 *************************************************************************** PP TIGR01246 226 sslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklikk 300 +s+qi+n++agtg++nviPg l++ fn+rfs+e+++e+lk++ ++ildkh+ld+++ew lsg pflt+ g l++ lcl|FitnessBrowser__psRCH2:GFF1581 235 TSFQISNLNAGTGTTNVIPGTLEAVFNFRFSTESTVEQLKQRTAAILDKHGLDWNVEWALSGLPFLTEPGALLDG 309 *************************************************************************** PP TIGR01246 301 vaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklleel 370 va+ai+ v++++++ stsGGtsD+rfia+lg++vvelG+vn+tih+v+e++ +dl+ l+++y+ +l +l lcl|FitnessBrowser__psRCH2:GFF1581 310 VAKAIRSVTGRETTPSTSGGTSDGRFIATLGTQVVELGPVNATIHQVDEHILASDLDLLTDIYYLTLVNL 379 ****************************************************************999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (382 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 11.95 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory