Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate GFF1581 Psest_1618 succinyl-diaminopimelate desuccinylase, proteobacterial clade
Query= BRENDA::Q9KQ52 (377 letters) >lcl|FitnessBrowser__psRCH2:GFF1581 Psest_1618 succinyl-diaminopimelate desuccinylase, proteobacterial clade Length = 382 Score = 480 bits (1236), Expect = e-140 Identities = 240/374 (64%), Positives = 279/374 (74%), Gaps = 1/374 (0%) Query: 4 SPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQSPLF 63 SP L LA ELI+R SVTP D GCQ LM +RL A GF IE M ED NFWA RG++ P+ Sbjct: 7 SPTLELACELINRPSVTPLDEGCQQLMTQRLAACGFAIEPMHIEDVENFWAIRGSEGPVL 66 Query: 64 VFAGHTDVVPAGPLSQWHTPPFEPTVID-GFLHGRGAADMKGSLACMIVAVERFIAEHPD 122 FAGHTDVVP GPL W PPF + + G LHGRGAADMKGSLA M+VAVERF A HPD Sbjct: 67 CFAGHTDVVPTGPLQAWQNPPFSARIDEQGMLHGRGAADMKGSLAAMVVAVERFTAAHPD 126 Query: 123 HQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRRGS 182 H+G I FLITSDEEGP +GT VVE L R + +D CIVGEPSST VGDVVKNGRRGS Sbjct: 127 HKGQIAFLITSDEEGPAHHGTKAVVERLRERGQRLDWCIVGEPSSTTLVGDVVKNGRRGS 186 Query: 183 ITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQAGT 242 + G L V+G QGHVAYPHLA NP+H A PALAELAA WD+GNA+FPPTSFQI NL AGT Sbjct: 187 LGGTLTVRGQQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQISNLNAGT 246 Query: 243 GASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTGEL 302 G +NVIPG + FNFRFSTE T E++K+R ++LD HGLD++V+W LSG PFLT+ G L Sbjct: 247 GTTNVIPGTLEAVFNFRFSTESTVEQLKQRTAAILDKHGLDWNVEWALSGLPFLTEPGAL 306 Query: 303 LAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADLE 362 L V A+ V + T+GGTSDGRFIA +G QVVELGPVNATIH+V+E + +DL+ Sbjct: 307 LDGVAKAIRSVTGRETTPSTSGGTSDGRFIATLGTQVVELGPVNATIHQVDEHILASDLD 366 Query: 363 KLTDMYQKTLNHLL 376 LTD+Y TL +LL Sbjct: 367 LLTDIYYLTLVNLL 380 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 382 Length adjustment: 30 Effective length of query: 347 Effective length of database: 352 Effective search space: 122144 Effective search space used: 122144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate GFF1581 Psest_1618 (succinyl-diaminopimelate desuccinylase, proteobacterial clade)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.27614.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-167 543.6 0.0 1.3e-167 543.4 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF1581 Psest_1618 succinyl-diaminopimel Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF1581 Psest_1618 succinyl-diaminopimelate desuccinylase, proteobacterial clade # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 543.4 0.0 1.3e-167 1.3e-167 2 370 .] 10 379 .. 9 379 .. 0.99 Alignments for each domain: == domain 1 score: 543.4 bits; conditional E-value: 1.3e-167 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaGelekWs 76 lela+eLi+r+svtP d+g+q+l+++rL + gf+ie +++ed++n+wa rg e pvl+faGhtDvvP+G+l++W+ lcl|FitnessBrowser__psRCH2:GFF1581 10 LELACELINRPSVTPLDEGCQQLMTQRLAACGFAIEPMHIEDVENFWAIRGSEGPVLCFAGHTDVVPTGPLQAWQ 84 689************************************************************************ PP TIGR01246 77 sdpfepee.rdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerde 150 ++pf++++ ++G+l+grGaaDmkgslaa+vva+erf ++++dhkG++++litsDeeg a +Gtk+vve l+er + lcl|FitnessBrowser__psRCH2:GFF1581 85 NPPFSARIdEQGMLHGRGAADMKGSLAAMVVAVERFTAAHPDHKGQIAFLITSDEEGPAHHGTKAVVERLRERGQ 159 *****987257**************************************************************** PP TIGR01246 151 lidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffpp 225 +d+++vgePss+ +GDv+k+GrrGs+ g+l+++G qGhvaYPh+a+nP+h a+p+l+el+a+++D+Gn+ffpp lcl|FitnessBrowser__psRCH2:GFF1581 160 RLDWCIVGEPSSTTLVGDVVKNGRRGSLGGTLTVRGQQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPP 234 *************************************************************************** PP TIGR01246 226 sslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklikk 300 +s+qi+n++agtg++nviPg l++ fn+rfs+e+++e+lk++ ++ildkh+ld+++ew lsg pflt+ g l++ lcl|FitnessBrowser__psRCH2:GFF1581 235 TSFQISNLNAGTGTTNVIPGTLEAVFNFRFSTESTVEQLKQRTAAILDKHGLDWNVEWALSGLPFLTEPGALLDG 309 *************************************************************************** PP TIGR01246 301 vaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklleel 370 va+ai+ v++++++ stsGGtsD+rfia+lg++vvelG+vn+tih+v+e++ +dl+ l+++y+ +l +l lcl|FitnessBrowser__psRCH2:GFF1581 310 VAKAIRSVTGRETTPSTSGGTSDGRFIATLGTQVVELGPVNATIHQVDEHILASDLDLLTDIYYLTLVNL 379 ****************************************************************999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (382 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.68 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory