Align Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate GFF4018 Psest_4091 diaminobutyrate--2-oxoglutarate aminotransferase
Query= curated2:Q8ZV07 (383 letters) >FitnessBrowser__psRCH2:GFF4018 Length = 425 Score = 176 bits (446), Expect = 1e-48 Identities = 119/370 (32%), Positives = 203/370 (54%), Gaps = 32/370 (8%) Query: 28 GQRYIDCNTNHGVVFLGHANPKIVEAVKKQVEEIWAVP-LNFATPARERFIEEFSKL-LP 85 G+RYID G + GH +P + +A+ + +E L+ T A+ERF+E F++L L Sbjct: 35 GKRYIDFLAGAGTLNYGHNHPVLKQALLEYIENDGITHGLDMYTAAKERFLETFNRLILE 94 Query: 86 PK----FGVVFLQNTGTEAVEVAIKIAKKVTRKPTIVAFTNSFHGRTMGSLSITWNEKYK 141 P+ + + F TGT AVE A+K+A+KVT + I++FTN FHG ++G+L+ T N+ ++ Sbjct: 95 PRGMGDYRMQFTGPTGTNAVEAAMKLARKVTGRNNIISFTNGFHGCSIGALAATGNQHHR 154 Query: 142 --------KAFEPLYPHVRFGKFNVPHEVDKLIGEDT------CCVVVEPIQGEGGVNPA 187 Y + K N +DKL+ + + V+VE +QGEGG+N A Sbjct: 155 GGSGISLTDVSRMPYANYFGDKTNTIGMMDKLLSDPSSGIDKPAAVIVEVVQGEGGLNTA 214 Query: 188 TPEFLKALREEAQRKGALLIFDEVQTGFGRTGAVWAFQKYGVEPDIFTAGKPVAG-GLPI 246 + E+++ L + ++ LLI D++Q G GRTG ++F++ G++PDI T K ++G GLP Sbjct: 215 STEWMRKLEKLCRKHEMLLIVDDIQAGCGRTGTFFSFEEMGIQPDIVTLSKSLSGYGLPF 274 Query: 247 GLAVAREDFGDVFEPGEHGSTFAGNAVVMAAAAAASRLLREED-----VPGRAERIGAEL 301 + + R++ D ++PGEH TF GN AAAA + D V + +RI + Sbjct: 275 AMVLLRQEL-DQWKPGEHNGTFRGNNHAFVTAAAAVEHFWQNDAFANSVKAKGKRIADGM 333 Query: 302 AKALGDTGSRLAVRVKGMGLMLGLEL--RVKADQFIQPLLERGVMALTAGVNT--LRFLP 357 + + G ++ +KG G+M+G+ A + E G++ T+G ++ ++ L Sbjct: 334 QRIIRRHGPD-SLYLKGRGMMIGISCPDGEIAAAVCRHAFENGLVIETSGAHSEVVKCLC 392 Query: 358 PYMISKEDVE 367 P +IS+E ++ Sbjct: 393 PLIISEEQID 402 Lambda K H 0.320 0.138 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 425 Length adjustment: 31 Effective length of query: 352 Effective length of database: 394 Effective search space: 138688 Effective search space used: 138688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory