Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (characterized)
to candidate GFF4148 Psest_4221 homoserine kinase, Neisseria type
Query= SwissProt::P29364 (316 letters) >FitnessBrowser__psRCH2:GFF4148 Length = 317 Score = 414 bits (1064), Expect = e-120 Identities = 216/316 (68%), Positives = 240/316 (75%), Gaps = 1/316 (0%) Query: 1 MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVERGPVQD 60 MSVFTPL+R LEAFLAPY LGRLRDF+GI GSENSNFFVSLE GE+VLTL+ERGP QD Sbjct: 1 MSVFTPLQRDELEAFLAPYRLGRLRDFQGIVAGSENSNFFVSLEQGEYVLTLIERGPRQD 60 Query: 61 LPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNAHHCQEV 120 LPFFIELLDVLH GLPVPYALR+ DG+ALR L KPALLQPRL G+H +PN H C EV Sbjct: 61 LPFFIELLDVLHRAGLPVPYALRSEDGDALRELAEKPALLQPRLPGKHVVEPNPHQCAEV 120 Query: 121 GDLLGHLHAATRGRILERPSDRGLPWMLEQGANLAPRLPEQARALLAPALAEIAALDAER 180 G LL LH ATR ILER SDRGL WM EQG +LA L E LL LAEIA L + Sbjct: 121 GRLLARLHLATREHILERASDRGLDWMQEQGPSLALSLSEDQLPLLRDGLAEIAELRPKL 180 Query: 181 PALPRANLHADLFRDNVLFDGPHLAGLIDFYNACSGWMLYDLAITLNDWCSNTDGSLDPA 240 ALPRANLHADLFRDNVLF+G HL G+IDFYNACSG MLYDLAI +NDWCS+ +G +D Sbjct: 181 LALPRANLHADLFRDNVLFEGSHLTGVIDFYNACSGPMLYDLAIAVNDWCSHPNGEIDGE 240 Query: 241 RARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRLIAAEAFAGQ-DVLIHDPAEFE 299 R+ LLAAY+ R FT EAE W MLRVACVRFWLSRLIAA+ G+ DV + DP EF Sbjct: 241 RSEPLLAAYSALRRFTPAEAELWQPMLRVACVRFWLSRLIAAQRHEGKTDVQVKDPDEFH 300 Query: 300 IRLAQRQNVEIHLPFA 315 L+ RQ+ + LPFA Sbjct: 301 RLLSARQHPQSVLPFA 316 Lambda K H 0.324 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 317 Length adjustment: 27 Effective length of query: 289 Effective length of database: 290 Effective search space: 83810 Effective search space used: 83810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
Align candidate GFF4148 Psest_4221 (homoserine kinase, Neisseria type)
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00938.hmm # target sequence database: /tmp/gapView.6961.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00938 [M=307] Accession: TIGR00938 Description: thrB_alt: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-85 273.4 0.0 1.4e-85 273.2 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF4148 Psest_4221 homoserine kinase, Ne Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF4148 Psest_4221 homoserine kinase, Neisseria type # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 273.2 0.0 1.4e-85 1.4e-85 1 306 [. 1 304 [. 1 305 [. 0.98 Alignments for each domain: == domain 1 score: 273.2 bits; conditional E-value: 1.4e-85 TIGR00938 1 mavytsvsdeeleafLegydlGellslkGiaeGvensnyllttdkgryvLtlyekrvkaeeLPfflellthLaer 75 m+v+t + +eleafL y lG+l +++Gi G ensn+++ ++g yvLtl e+ ++LPff+ell+ L lcl|FitnessBrowser__psRCH2:GFF4148 1 MSVFTPLQRDELEAFLAPYRLGRLRDFQGIVAGSENSNFFVSLEQGEYVLTLIERGP-RQDLPFFIELLDVLHRA 74 9*****************************************************999.89*************** PP TIGR00938 76 glpvakpvksrdGralseLaGkPaalvefLkGssvakPtaercrevgevlaklhlagadfkeerkndlrleaWsi 150 glpv+ +++s+dG al eLa kPa l L+G+ v +P +++c+evg la+lhla+ ++ er+ r +W lcl|FitnessBrowser__psRCH2:GFF4148 75 GLPVPYALRSEDGDALRELAEKPALLQPRLPGKHVVEPNPHQCAEVGRLLARLHLATREHILERAS-DRGLDWMQ 148 *********************************************************999999998.68889*99 PP TIGR00938 151 laakkfkvleqleeelaalldkeldalkkflpr..dLPrgvihadlfkdnvlldgdklkgvidfyfaCedallyd 223 + ++ l+e++ ll++ l+ + ++ p+ LPr+ +hadlf+dnvl++g +l+gvidfy aC++ +lyd lcl|FitnessBrowser__psRCH2:GFF4148 149 EQGPS--LALSLSEDQLPLLRDGLAEIAELRPKllALPRANLHADLFRDNVLFEGSHLTGVIDFYNACSGPMLYD 221 99988..999**********************95568************************************** PP TIGR00938 224 laiavndWcfeaddkldaaaakallkgyeavrpLseeekaafpvllrgaalrfllsrlldlvftqagelvvakdP 298 laiavndWc + ++++d ++ ll +y a r +++ e + + +lr+a++rf+lsrl + + v++kdP lcl|FitnessBrowser__psRCH2:GFF4148 222 LAIAVNDWCSHPNGEIDGERSEPLLAAYSALRRFTPAEAELWQPMLRVACVRFWLSRLIAAQRHEGKTDVQVKDP 296 *************************************************************************** PP TIGR00938 299 aeferkLk 306 ef+r+L lcl|FitnessBrowser__psRCH2:GFF4148 297 DEFHRLLS 304 *****985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (317 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.00 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory