Align Homoserine O-acetyltransferase; HAT; EC 2.3.1.31; Homoserine transacetylase; HTA (uncharacterized)
to candidate GFF279 Psest_0280 homoserine O-acetyltransferase
Query= curated2:Q1QQD3 (399 letters) >FitnessBrowser__psRCH2:GFF279 Length = 379 Score = 375 bits (964), Expect = e-109 Identities = 185/361 (51%), Positives = 245/361 (67%), Gaps = 3/361 (0%) Query: 26 QVAMFAGDQPLPLDCGIDLAPFQIAYQTYGELNAGKSNAILVCHALTGDQHVANVHPVTG 85 Q+A FA +PL L CG LA +Q+ Y+TYGELNA +SNA+L+CHAL+G H A H Sbjct: 16 QIAHFA--EPLTLACGRTLADYQLIYETYGELNAARSNAVLICHALSGHHHAAGYHSEDD 73 Query: 86 -KPGWWVTLVGPGKPLDTDKYFVICSNVIGGCMGSTGPASTNPATGTVWGLDFPVITIPD 144 KPGWW + +GPGK +DT+++FV+ N +GGC GSTGP+STNPA+G +G DFPV+T+ D Sbjct: 74 RKPGWWDSCIGPGKAIDTNRFFVVSLNNLGGCNGSTGPSSTNPASGKPYGADFPVVTVED 133 Query: 145 MVRAQAMLIDRLGIDTLFSVVGGSMGGMQVLQWCVAYPQRVFSALPIACSTRHSAQNIAF 204 V +QA L DRLGI +VVGGS+GGMQ LQW ++YP+RV L IA + + SAQNIAF Sbjct: 134 WVHSQARLADRLGIAQWAAVVGGSLGGMQALQWTISYPERVRHCLAIASAPKLSAQNIAF 193 Query: 205 HELGRQAVMADPDWRDGRYVEQGTYPHRGLGVARMAAHITYLSDAALHRKFGRRMQDRDL 264 +E+ RQA+++DP++ G + E G P RGL +ARM HITYLSD A+ KFGR ++ L Sbjct: 194 NEVARQAILSDPEFHGGHFQEMGVIPKRGLMLARMVGHITYLSDDAMGTKFGRGLKSEKL 253 Query: 265 PTFSFDADFQVESYLRHQGSSFVERFDANSYLYLTRAMDYFDIAADHNGVLAAAFRDTRT 324 +FQVESYLR+QG F RFDAN+YL +T+A+DYFD AA ++ LA F + Sbjct: 254 NYDFNSVEFQVESYLRYQGEEFSGRFDANTYLLMTKALDYFDPAAANDDDLAKTFEVAKA 313 Query: 325 RFCVVSFTSDWLFPTSESRATVHALNAGGARVSFAEIETDRGHDAFLLDLPEFFDIAHAF 384 FCV+SFT+DW F SR V AL A V + EI+ +GHDAFL+ P + + Sbjct: 314 DFCVMSFTTDWRFSPERSREIVDALLAARKNVCYLEIDAPQGHDAFLIPNPRYLQAFRGY 373 Query: 385 L 385 + Sbjct: 374 M 374 Lambda K H 0.323 0.136 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 431 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 399 Length of database: 379 Length adjustment: 30 Effective length of query: 369 Effective length of database: 349 Effective search space: 128781 Effective search space used: 128781 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
Align candidate GFF279 Psest_0280 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.6417.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-144 467.1 0.0 2.1e-144 466.9 0.0 1.0 1 lcl|FitnessBrowser__psRCH2:GFF279 Psest_0280 homoserine O-acetyltr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__psRCH2:GFF279 Psest_0280 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 466.9 0.0 2.1e-144 2.1e-144 3 350 .. 22 374 .. 20 375 .. 0.97 Alignments for each domain: == domain 1 score: 466.9 bits; conditional E-value: 2.1e-144 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpgraldtsryfvv 76 e+ltl +G +l ++++ y+tyG+lna+r+Navl+cHal+g++h+ag+++e+d+ GWWd+ +Gpg+a+dt+r+fvv lcl|FitnessBrowser__psRCH2:GFF279 22 EPLTLACGRTLADYQLIYETYGELNAARSNAVLICHALSGHHHAAGYHSEDDRkpGWWDSCIGPGKAIDTNRFFVV 97 79**********************************************9988889********************* PP TIGR01392 77 clNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGGmqalewalsyper 152 +lN+lG+c+GstgP+s+np++gkpyga+fP+vt++D+v+ q++l+d+Lg+ ++aavvGgSlGGmqal+w++syper lcl|FitnessBrowser__psRCH2:GFF279 98 SLNNLGGCNGSTGPSSTNPASGKPYGADFPVVTVEDWVHSQARLADRLGIAQWAAVVGGSLGGMQALQWTISYPER 173 **************************************************************************** PP TIGR01392 153 vkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARmlalltYrseesleerfgreak 227 v++++++a+++++saq+iafnev+rqailsDpe+++G+++e + P++GL lARm++++tY+s++++ ++fgr k lcl|FitnessBrowser__psRCH2:GFF279 174 VRHCLAIASAPKLSAQNIAFNEVARQAILSDPEFHGGHFQEMGvIPKRGLMLARMVGHITYLSDDAMGTKFGRGLK 249 *******************************************9*******************************9 PP TIGR01392 228 seeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdlargrrdslkealkkikapvlvvgiesDll 303 se+ + ef+vesylryqg++f rFdAn+Yll+tkald++d a+ ++d+l+++++ +ka+++v+++++D++ lcl|FitnessBrowser__psRCH2:GFF279 250 SEKLNYDFNSVEFQVESYLRYQGEEFSGRFDANTYLLMTKALDYFDPAAANDDDLAKTFEVAKADFCVMSFTTDWR 325 99666665699***************************************************************** PP TIGR01392 304 ftleeqeelakalkaakle..yaeieseeGHDaFllekekveelirefl 350 f++e+++e+++al aa+++ y ei+ ++GHDaFl+ + ++ ++ r ++ lcl|FitnessBrowser__psRCH2:GFF279 326 FSPERSREIVDALLAARKNvcYLEIDAPQGHDAFLIPNPRYLQAFRGYM 374 ****************99999***************9999888877665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (379 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.27 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory