Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate GFF2528 Psest_2578 O-succinylhomoserine sulfhydrylase
Query= reanno::Korea:Ga0059261_3194 (402 letters) >FitnessBrowser__psRCH2:GFF2528 Length = 403 Score = 335 bits (859), Expect = 1e-96 Identities = 178/384 (46%), Positives = 242/384 (63%), Gaps = 3/384 (0%) Query: 19 TQAIRGGTARSEWGETSEALFLTSGYAYDCAGDAAARFSGDQQGMTYSRLQNPTVEMLEQ 78 T A+R G R+ GE E LF TS Y + A DAAARF+GD G YSR NPTV E+ Sbjct: 21 TLAVRAGQRRTPEGEHGEPLFFTSSYVFRSAADAAARFAGDVPGNVYSRYTNPTVRAFEE 80 Query: 79 RIALLEGAEACRATASGMAAMTAALLCQLSAGDHLIGGRAAFGSCRWLTDTQLPKFGIET 138 RIA LEGAE ATASGMAA+ A ++ +AGDH++ R+ FG+ L + L +FG++ Sbjct: 81 RIAALEGAEQAVATASGMAAILATVMSLCAAGDHVLVSRSVFGATVSLFEKYLKRFGVQV 140 Query: 139 TVVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCAIARERGIVTVVDNAFATP 198 V D + A + NTK+ F E+P+NP ++VD+ A+ + +G + VDN F TP Sbjct: 141 DYVPLTDFSAWESAFQENTKLVFVESPSNPLAELVDIAALAKLCHAKGAMLAVDNCFCTP 200 Query: 199 ALQRPMDFGADVVAYSATKMMDGQGRVLAGAVCGTEEFINNTLLPFHRNTGPTLSPFNAW 258 LQ+P+ GAD+V +SATK +DGQGR L G V G E + L+ F R GPTLSPFNAW Sbjct: 201 VLQQPLALGADIVIHSATKYIDGQGRCLGGVVAGRSEQMKE-LVGFLRTAGPTLSPFNAW 259 Query: 259 VVLKGLETLDLRIQRQSENALKVARFLEGR--VPRVNFPGLPSHPQHNLAMSQMAAAGPI 316 V LKGLETL LR+Q +A ++A +LE + + RV + GLPSHPQH LA Q G + Sbjct: 260 VFLKGLETLRLRMQAHCASAQELAEWLEQQPGIERVYYAGLPSHPQHELAKRQQKGFGAV 319 Query: 317 FSIELDGGRTQAHGLLDALGLIDISNNIGDSRSLMTHPASTTHSGVAEDQRLLMGVGEGM 376 S E+ GG+ A +DA LI I+ N+GDS++ +THP STTH ++ + R G+ + + Sbjct: 320 VSFEVAGGKEAAWRFIDATRLISITANLGDSKTTITHPGSTTHGRLSAEDRATAGIRDSL 379 Query: 377 LRLNVGLEDPEDLIADLDQALGSV 400 +R+ VGLED DL ADL + L ++ Sbjct: 380 IRVAVGLEDVADLKADLARGLAAL 403 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 409 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 403 Length adjustment: 31 Effective length of query: 371 Effective length of database: 372 Effective search space: 138012 Effective search space used: 138012 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory